Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | VapXD/- |
| Location | 183168..183646 | Replicon | chromosome |
| Accession | NZ_LS483411 | ||
| Organism | Haemophilus influenzae strain NCTC11426 | ||
Toxin (Protein)
| Gene name | VapD | Uniprot ID | A0A112WLN3 |
| Locus tag | DQN24_RS00945 | Protein ID | WP_021034684.1 |
| Coordinates | 183168..183446 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | VapX | Uniprot ID | A0A0K9KX05 |
| Locus tag | DQN24_RS00950 | Protein ID | WP_012055040.1 |
| Coordinates | 183455..183646 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQN24_RS00925 | 178356..180026 | - | 1671 | WP_111695252.1 | fructose-specific PTS transporter subunit EIIC | - |
| DQN24_RS00930 | 180028..180969 | - | 942 | WP_021034687.1 | 1-phosphofructokinase | - |
| DQN24_RS00935 | 180971..182470 | - | 1500 | WP_021034686.1 | fused PTS fructose transporter subunit IIA/HPr protein | - |
| DQN24_RS00940 | 182542..183072 | - | 531 | WP_021034685.1 | hypothetical protein | - |
| DQN24_RS00945 | 183168..183446 | - | 279 | WP_021034684.1 | virulence-associated protein VapD | Toxin |
| DQN24_RS00950 | 183455..183646 | - | 192 | WP_012055040.1 | DUF5397 family protein | Antitoxin |
| DQN24_RS00955 | 183717..185015 | - | 1299 | WP_021034683.1 | hemolysin family protein | - |
| DQN24_RS00960 | 185066..185590 | - | 525 | WP_005669286.1 | DUF1523 family protein | - |
| DQN24_RS00965 | 185617..186399 | - | 783 | WP_111695253.1 | YchF/TatD family DNA exonuclease | - |
| DQN24_RS00970 | 186435..187415 | - | 981 | WP_021034681.1 | DNA polymerase III subunit delta' | - |
| DQN24_RS00975 | 187412..188044 | - | 633 | WP_172453993.1 | dTMP kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10647.01 Da Isoelectric Point: 4.9670
>T292518 WP_021034684.1 NZ_LS483411:c183446-183168 [Haemophilus influenzae]
MYAIAFDLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYTNTNEDMANLFQAMNELKQLAWISQSVRDIRAFRI
EQWSDFTDFIRS
MYAIAFDLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYTNTNEDMANLFQAMNELKQLAWISQSVRDIRAFRI
EQWSDFTDFIRS
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A112WLN3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9KX05 |