Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prpT-prpA/CC2985(antitoxin) |
Location | 2330577..2331117 | Replicon | chromosome |
Accession | NZ_LS483410 | ||
Organism | Legionella pneumophila strain NCTC11404 |
Toxin (Protein)
Gene name | PrpT | Uniprot ID | - |
Locus tag | DQN67_RS10655 | Protein ID | WP_014844324.1 |
Coordinates | 2330821..2331117 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PrpA | Uniprot ID | - |
Locus tag | DQN67_RS10650 | Protein ID | WP_027224835.1 |
Coordinates | 2330577..2330831 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN67_RS10630 | 2326481..2327656 | - | 1176 | WP_027224832.1 | ISL3 family transposase | - |
DQN67_RS10635 | 2327695..2328825 | - | 1131 | WP_064319116.1 | ISL3 family transposase | - |
DQN67_RS10640 | 2328980..2329558 | + | 579 | WP_027224833.1 | hypothetical protein | - |
DQN67_RS10645 | 2329663..2330229 | + | 567 | WP_027224834.1 | hypothetical protein | - |
DQN67_RS10650 | 2330577..2330831 | + | 255 | WP_027224835.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
DQN67_RS10655 | 2330821..2331117 | + | 297 | WP_014844324.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN67_RS10665 | 2331578..2332592 | - | 1015 | Protein_2057 | transposase | - |
DQN67_RS10670 | 2332855..2333064 | + | 210 | WP_010947832.1 | cold-shock protein | - |
DQN67_RS10675 | 2333304..2334710 | + | 1407 | WP_014844326.1 | ATP-dependent RNA helicase DbpA | - |
DQN67_RS10680 | 2334867..2335778 | + | 912 | WP_014844327.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2325077..2337190 | 12113 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11582.28 Da Isoelectric Point: 7.2728
>T292516 WP_014844324.1 NZ_LS483410:2330821-2331117 [Legionella pneumophila]
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKRTEDYILAIDLSFQRLADDPLIARKCDYIRPELRAFNVGSHIIFFKTTDY
GISVIRVLHQSMDFNRHL
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKRTEDYILAIDLSFQRLADDPLIARKCDYIRPELRAFNVGSHIIFFKTTDY
GISVIRVLHQSMDFNRHL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|