Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/DinJ(antitoxin) |
Location | 1838762..1839368 | Replicon | chromosome |
Accession | NZ_LS483409 | ||
Organism | Streptococcus gallolyticus strain NCTC13773 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQN21_RS09170 | Protein ID | WP_077497399.1 |
Coordinates | 1838762..1839094 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1S5WDU6 |
Locus tag | DQN21_RS09175 | Protein ID | WP_009854657.1 |
Coordinates | 1839084..1839368 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN21_RS09145 | 1834193..1834801 | - | 609 | WP_009854651.1 | TVP38/TMEM64 family protein | - |
DQN21_RS09150 | 1835049..1835351 | - | 303 | WP_009854652.1 | PepSY domain-containing protein | - |
DQN21_RS09155 | 1835594..1837099 | - | 1506 | WP_174564820.1 | HAMP domain-containing histidine kinase | - |
DQN21_RS09160 | 1837071..1837763 | - | 693 | WP_009854654.1 | response regulator transcription factor | - |
DQN21_RS09165 | 1837869..1838747 | - | 879 | WP_077497397.1 | DUF3114 domain-containing protein | - |
DQN21_RS09170 | 1838762..1839094 | - | 333 | WP_077497399.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
DQN21_RS09175 | 1839084..1839368 | - | 285 | WP_009854657.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DQN21_RS09180 | 1839642..1840160 | + | 519 | WP_077497401.1 | TetR/AcrR family transcriptional regulator | - |
DQN21_RS09185 | 1840274..1842043 | + | 1770 | WP_009854659.1 | oleate hydratase | - |
DQN21_RS09190 | 1842173..1843000 | - | 828 | WP_077497403.1 | class C sortase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12975.92 Da Isoelectric Point: 8.6852
>T292514 WP_077497399.1 NZ_LS483409:c1839094-1838762 [Streptococcus gallolyticus]
MDYKKYKLIYSQRGIDTLDDIYHYIANEIGSTINAKKKIASIRKDLQRLEFFPEGGFDADEKFGKCLDPKYKTRGLTLSK
DYIALYNILENEVRIAYLLPTRSDYMDLFR
MDYKKYKLIYSQRGIDTLDDIYHYIANEIGSTINAKKKIASIRKDLQRLEFFPEGGFDADEKFGKCLDPKYKTRGLTLSK
DYIALYNILENEVRIAYLLPTRSDYMDLFR
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|