Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB-HicA |
Location | 1662519..1663099 | Replicon | chromosome |
Accession | NZ_LS483409 | ||
Organism | Streptococcus gallolyticus strain NCTC13773 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | F5WVJ0 |
Locus tag | DQN21_RS08380 | Protein ID | WP_009854536.1 |
Coordinates | 1662911..1663099 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | DQN21_RS08375 | Protein ID | WP_077497294.1 |
Coordinates | 1662519..1662899 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN21_RS08360 | 1657982..1658458 | - | 477 | WP_014294902.1 | shikimate kinase | - |
DQN21_RS08365 | 1658451..1659734 | - | 1284 | WP_077497290.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
DQN21_RS08370 | 1659956..1661791 | - | 1836 | WP_077497292.1 | translation elongation factor 4 | - |
DQN21_RS08375 | 1662519..1662899 | - | 381 | WP_077497294.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DQN21_RS08380 | 1662911..1663099 | - | 189 | WP_009854536.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DQN21_RS08385 | 1663195..1663860 | - | 666 | WP_174564805.1 | type II-A CRISPR-associated protein Csn2 | - |
DQN21_RS08390 | 1663847..1664191 | - | 345 | WP_009854538.1 | CRISPR-associated endonuclease Cas2 | - |
DQN21_RS08395 | 1664188..1665054 | - | 867 | WP_077497298.1 | type II CRISPR-associated endonuclease Cas1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6837.25 Da Isoelectric Point: 10.8207
>T292513 WP_009854536.1 NZ_LS483409:c1663099-1662911 [Streptococcus gallolyticus]
VPLTGRELAKLAVLKGWKEVRVKGSHHQFKKDGVPYILTIPIHGNKVLGVGLEKKILKDIGL
VPLTGRELAKLAVLKGWKEVRVKGSHHQFKKDGVPYILTIPIHGNKVLGVGLEKKILKDIGL
Download Length: 189 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14165.04 Da Isoelectric Point: 4.2627
>AT292513 WP_077497294.1 NZ_LS483409:c1662899-1662519 [Streptococcus gallolyticus]
MLKSYPAIFHKEDDGSFWVEFPGFGGGTEGDDVEEAMKNAREMLESSLAAYLDEGLELPKVVDMSELSVEDGFITLIQAD
PSPYLKSTKAIRKNVTVPEWLVRLADREHVNYSEVLTQALEKKLQL
MLKSYPAIFHKEDDGSFWVEFPGFGGGTEGDDVEEAMKNAREMLESSLAAYLDEGLELPKVVDMSELSVEDGFITLIQAD
PSPYLKSTKAIRKNVTVPEWLVRLADREHVNYSEVLTQALEKKLQL
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|