Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 710708..711194 | Replicon | chromosome |
Accession | NZ_LS483409 | ||
Organism | Streptococcus gallolyticus strain NCTC13773 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1S5WAV3 |
Locus tag | DQN21_RS03890 | Protein ID | WP_009853752.1 |
Coordinates | 710925..711194 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | F5WZP8 |
Locus tag | DQN21_RS03885 | Protein ID | WP_013642845.1 |
Coordinates | 710708..710935 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN21_RS03865 | 706845..707159 | + | 315 | WP_003063779.1 | metalloregulator ArsR/SmtB family transcription factor | - |
DQN21_RS03870 | 707162..709045 | + | 1884 | WP_077496480.1 | cadmium-translocating P-type ATPase | - |
DQN21_RS03875 | 709205..709525 | + | 321 | WP_077496482.1 | multidrug efflux SMR transporter | - |
DQN21_RS03880 | 709742..710434 | + | 693 | WP_009853732.1 | phosphoglycerate mutase | - |
DQN21_RS03885 | 710708..710935 | + | 228 | WP_013642845.1 | hypothetical protein | Antitoxin |
DQN21_RS03890 | 710925..711194 | + | 270 | WP_009853752.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN21_RS03895 | 711573..712139 | - | 567 | WP_009853753.1 | DUF3267 domain-containing protein | - |
DQN21_RS03900 | 712390..712911 | + | 522 | WP_009853754.1 | transcription repressor NadR | - |
DQN21_RS03905 | 713108..713662 | + | 555 | WP_043878534.1 | hypothetical protein | - |
DQN21_RS03910 | 713817..715970 | + | 2154 | WP_009853756.1 | penicillin-binding protein PBP2B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10554.64 Da Isoelectric Point: 10.4700
>T292511 WP_009853752.1 NZ_LS483409:710925-711194 [Streptococcus gallolyticus]
MTYRLVVSDKVKKQLKKMDKHVRLMLAKDMKKHLDGLENPRQIGKALIGQFKGLWRYRIGNYRVICDIMDDELVILAIEI
GHRKDIYKN
MTYRLVVSDKVKKQLKKMDKHVRLMLAKDMKKHLDGLENPRQIGKALIGQFKGLWRYRIGNYRVICDIMDDELVILAIEI
GHRKDIYKN
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S5WAV3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S5WAU8 |