Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 277190..277741 Replicon chromosome
Accession NZ_LS483409
Organism Streptococcus gallolyticus strain NCTC13773

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag DQN21_RS01625 Protein ID WP_077496088.1
Coordinates 277190..277468 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag DQN21_RS01630 Protein ID WP_077496090.1
Coordinates 277469..277741 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQN21_RS01590 273297..273551 - 255 WP_049533167.1 Txe/YoeB family addiction module toxin -
DQN21_RS01595 273544..273810 - 267 WP_077496080.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
DQN21_RS01600 274074..275732 - 1659 WP_077496082.1 cell division protein FtsK -
DQN21_RS01605 275739..276149 - 411 WP_003041912.1 DUF961 family protein -
DQN21_RS01610 276172..276486 - 315 WP_000406626.1 hypothetical protein -
DQN21_RS01615 276601..276828 - 228 WP_077496084.1 TetR family transcriptional regulator -
DQN21_RS01620 276825..277061 - 237 WP_077496086.1 hypothetical protein -
DQN21_RS01625 277190..277468 - 279 WP_077496088.1 type II toxin-antitoxin system YafQ family toxin Toxin
DQN21_RS01630 277469..277741 - 273 WP_077496090.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
DQN21_RS01635 278415..278777 + 363 WP_049533221.1 helix-turn-helix domain-containing protein -
DQN21_RS01640 278784..279635 + 852 WP_174564796.1 ImmA/IrrE family metallo-endopeptidase -
DQN21_RS01645 279655..280008 - 354 WP_077496092.1 hypothetical protein -
DQN21_RS01655 280318..280788 + 471 WP_077497992.1 hypothetical protein -
DQN21_RS01660 280815..281057 + 243 Protein_273 hypothetical protein -
DQN21_RS01665 281076..281557 - 482 Protein_274 IS982 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 220836..290248 69412


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-81)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10908.78 Da        Isoelectric Point: 8.0384

>T292510 WP_077496088.1 NZ_LS483409:c277468-277190 [Streptococcus gallolyticus]
MYQVKFTSAFKKSYKRIKKRGLEMALLDEVIEKLRLGQTLEEKYRDHELKGNFVGFRECHIKPDWLLIYLIEEDILTLTL
ADTGSHADLFKM

Download         Length: 279 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9891.32 Da        Isoelectric Point: 4.7085

>AT292510 WP_077496090.1 NZ_LS483409:c277741-277469 [Streptococcus gallolyticus]
MATVPTQIRIDETVKAQATSLFNDLGMDMSSAVNIFLRQCLLRGGLPFTVEVPNYSQKTLEALAEAKRISRDETVASYDN
LADLKKALDA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References