Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 259828..260437 | Replicon | chromosome |
Accession | NZ_LS483409 | ||
Organism | Streptococcus gallolyticus strain NCTC13773 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQN21_RS01505 | Protein ID | WP_077496054.1 |
Coordinates | 259828..260157 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1S5WA73 |
Locus tag | DQN21_RS01510 | Protein ID | WP_013642908.1 |
Coordinates | 260147..260437 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN21_RS01475 | 254927..255580 | + | 654 | WP_077496047.1 | hypothetical protein | - |
DQN21_RS12675 | 255643..256515 | + | 873 | WP_174564795.1 | DnaD domain protein | - |
DQN21_RS01490 | 256881..257375 | + | 495 | WP_077496049.1 | hypothetical protein | - |
DQN21_RS01495 | 257690..258946 | + | 1257 | WP_077496051.1 | plasmid recombination protein | - |
DQN21_RS01500 | 259119..259649 | + | 531 | WP_077496052.1 | hypothetical protein | - |
DQN21_RS01505 | 259828..260157 | - | 330 | WP_077496054.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN21_RS01510 | 260147..260437 | - | 291 | WP_013642908.1 | hypothetical protein | Antitoxin |
DQN21_RS01515 | 260837..262060 | - | 1224 | WP_077496056.1 | site-specific integrase | - |
DQN21_RS01520 | 262115..262388 | - | 274 | Protein_246 | helix-turn-helix domain-containing protein | - |
DQN21_RS01525 | 262500..262832 | - | 333 | WP_077496058.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
DQN21_RS01530 | 262819..263124 | - | 306 | WP_000162871.1 | hypothetical protein | - |
DQN21_RS01535 | 263181..264236 | - | 1056 | WP_077496059.1 | CHAP domain-containing protein | - |
DQN21_RS01540 | 264245..264472 | - | 228 | WP_077496061.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 220836..290248 | 69412 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12555.47 Da Isoelectric Point: 8.3467
>T292508 WP_077496054.1 NZ_LS483409:c260157-259828 [Streptococcus gallolyticus]
MDYKISYNAGALEALVEIKEYIINNFKSETSAKKVVDNIMQKISALEIFPEVGFDADERFGKTLDKRHKTRGLTIGKDYI
ALYFVNDEKKEVVITHIVSTRSDYVKLFK
MDYKISYNAGALEALVEIKEYIINNFKSETSAKKVVDNIMQKISALEIFPEVGFDADERFGKTLDKRHKTRGLTIGKDYI
ALYFVNDEKKEVVITHIVSTRSDYVKLFK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|