Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1576433..1577045 Replicon chromosome
Accession NZ_LS483407
Organism Streptococcus pyogenes strain NCTC13744

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag DQM86_RS08150 Protein ID WP_002994716.1
Coordinates 1576710..1577045 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQM86_RS08145 Protein ID WP_002988079.1
Coordinates 1576433..1576720 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM86_RS08120 1571624..1572607 - 984 WP_011184964.1 tagatose-bisphosphate aldolase -
DQM86_RS08125 1572611..1573540 - 930 WP_111674719.1 tagatose-6-phosphate kinase -
DQM86_RS08130 1573586..1574101 - 516 WP_002991700.1 galactose-6-phosphate isomerase subunit LacB -
DQM86_RS08135 1574136..1574564 - 429 WP_002991702.1 galactose-6-phosphate isomerase subunit LacA -
DQM86_RS08140 1575010..1575783 + 774 WP_011285171.1 DeoR/GlpR family DNA-binding transcription regulator -
DQM86_RS08145 1576433..1576720 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQM86_RS08150 1576710..1577045 + 336 WP_002994716.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM86_RS09330 1577197..1577667 + 471 WP_021733374.1 site-specific integrase -
DQM86_RS09335 1577630..1578178 + 549 WP_136115776.1 site-specific integrase -
DQM86_RS08160 1578298..1578690 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQM86_RS08165 1578711..1579157 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQM86_RS08170 1579375..1579581 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
DQM86_RS08175 1579578..1580084 - 507 WP_002988070.1 hypothetical protein -
DQM86_RS08180 1580220..1581080 - 861 WP_002982687.1 DegV family protein -
DQM86_RS08185 1581177..1581695 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(M) - 1535322..1580824 45502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-104)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13154.89 Da        Isoelectric Point: 5.6157

>T292505 WP_002994716.1 NZ_LS483407:1576710-1577045 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292505 WP_002988079.1 NZ_LS483407:1576433-1576720 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References