Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1576433..1577045 | Replicon | chromosome |
| Accession | NZ_LS483407 | ||
| Organism | Streptococcus pyogenes strain NCTC13744 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQM86_RS08150 | Protein ID | WP_002994716.1 |
| Coordinates | 1576710..1577045 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQM86_RS08145 | Protein ID | WP_002988079.1 |
| Coordinates | 1576433..1576720 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM86_RS08120 | 1571624..1572607 | - | 984 | WP_011184964.1 | tagatose-bisphosphate aldolase | - |
| DQM86_RS08125 | 1572611..1573540 | - | 930 | WP_111674719.1 | tagatose-6-phosphate kinase | - |
| DQM86_RS08130 | 1573586..1574101 | - | 516 | WP_002991700.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQM86_RS08135 | 1574136..1574564 | - | 429 | WP_002991702.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQM86_RS08140 | 1575010..1575783 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQM86_RS08145 | 1576433..1576720 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQM86_RS08150 | 1576710..1577045 | + | 336 | WP_002994716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM86_RS09330 | 1577197..1577667 | + | 471 | WP_021733374.1 | site-specific integrase | - |
| DQM86_RS09335 | 1577630..1578178 | + | 549 | WP_136115776.1 | site-specific integrase | - |
| DQM86_RS08160 | 1578298..1578690 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQM86_RS08165 | 1578711..1579157 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQM86_RS08170 | 1579375..1579581 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQM86_RS08175 | 1579578..1580084 | - | 507 | WP_002988070.1 | hypothetical protein | - |
| DQM86_RS08180 | 1580220..1581080 | - | 861 | WP_002982687.1 | DegV family protein | - |
| DQM86_RS08185 | 1581177..1581695 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(M) | - | 1535322..1580824 | 45502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13154.89 Da Isoelectric Point: 5.6157
>T292505 WP_002994716.1 NZ_LS483407:1576710-1577045 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|