Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | rlegTA/AbiEii-AbiEi |
Location | 687244..688712 | Replicon | chromosome |
Accession | NZ_LS483406 | ||
Organism | Stenotrophomonas maltophilia strain NCTC10498 |
Toxin (Protein)
Gene name | rlegT | Uniprot ID | - |
Locus tag | DQN96_RS03175 | Protein ID | WP_157803285.1 |
Coordinates | 687244..688113 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | rlegA | Uniprot ID | - |
Locus tag | DQN96_RS03180 | Protein ID | WP_032966430.1 |
Coordinates | 688110..688712 (-) | Length | 201 a.a. |
Genomic Context
Location: 686272..687090 (819 bp)
Type: Others
Protein ID: WP_060381104.1
Type: Others
Protein ID: WP_060381104.1
Location: 691336..691782 (447 bp)
Type: Others
Protein ID: WP_004143635.1
Type: Others
Protein ID: WP_004143635.1
Location: 691797..692765 (969 bp)
Type: Others
Protein ID: WP_012479154.1
Type: Others
Protein ID: WP_012479154.1
Location: 692762..693025 (264 bp)
Type: Others
Protein ID: WP_005412242.1
Type: Others
Protein ID: WP_005412242.1
Location: 683422..684000 (579 bp)
Type: Others
Protein ID: WP_100438875.1
Type: Others
Protein ID: WP_100438875.1
Location: 684111..684479 (369 bp)
Type: Others
Protein ID: WP_012479149.1
Type: Others
Protein ID: WP_012479149.1
Location: 684469..686190 (1722 bp)
Type: Others
Protein ID: WP_049459446.1
Type: Others
Protein ID: WP_049459446.1
Location: 687244..688113 (870 bp)
Type: Toxin
Protein ID: WP_157803285.1
Type: Toxin
Protein ID: WP_157803285.1
Location: 688110..688712 (603 bp)
Type: Antitoxin
Protein ID: WP_032966430.1
Type: Antitoxin
Protein ID: WP_032966430.1
Location: 689463..689942 (480 bp)
Type: Others
Protein ID: WP_100438877.1
Type: Others
Protein ID: WP_100438877.1
Location: 690260..691012 (753 bp)
Type: Others
Protein ID: WP_100438888.1
Type: Others
Protein ID: WP_100438888.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN96_RS03155 | 683422..684000 | - | 579 | WP_100438875.1 | metal-dependent hydrolase | - |
DQN96_RS03160 | 684111..684479 | - | 369 | WP_012479149.1 | YraN family protein | - |
DQN96_RS03165 | 684469..686190 | - | 1722 | WP_049459446.1 | penicillin-binding protein activator | - |
DQN96_RS03170 | 686272..687090 | + | 819 | WP_060381104.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
DQN96_RS03175 | 687244..688113 | - | 870 | WP_157803285.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | Toxin |
DQN96_RS03180 | 688110..688712 | - | 603 | WP_032966430.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | Antitoxin |
DQN96_RS03190 | 689463..689942 | - | 480 | WP_100438877.1 | DM13 domain-containing protein | - |
DQN96_RS03195 | 690260..691012 | - | 753 | WP_100438888.1 | NRDE family protein | - |
DQN96_RS03200 | 691336..691782 | + | 447 | WP_004143635.1 | division/cell wall cluster transcriptional repressor MraZ | - |
DQN96_RS03205 | 691797..692765 | + | 969 | WP_012479154.1 | 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH | - |
DQN96_RS03210 | 692762..693025 | + | 264 | WP_005412242.1 | cell division protein FtsL | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 674408..689942 | 15534 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32579.23 Da Isoelectric Point: 6.3012
>T292504 WP_157803285.1 NZ_LS483406:c688113-687244 [Stenotrophomonas maltophilia]
VTHSPPLPQRVASIRQRLLDLARSRGEDFQFVLDRFAVERLLYRLSASRYRDQFLLKGAMLFAVWFDAPHRPTRDADFLR
FGSADPDHLLHIARSLCAIPDDDGLCFDPGSIAIEATREEAEYEGLRIRLTAHLGRSRCHVQWDVGFGDAVTPPPPEIAY
PVMLDGFPLPCLHVYPRETVFAEKLEAIAALGIANSRMKDFFDLLALVREDAMDRPHLVAAIGATFDRRRTPAPPPLPYG
LTQSFAADTQKQTQWRAFLRRNRLIAPDLSSVIAEIADYLDTLDTTVQS
VTHSPPLPQRVASIRQRLLDLARSRGEDFQFVLDRFAVERLLYRLSASRYRDQFLLKGAMLFAVWFDAPHRPTRDADFLR
FGSADPDHLLHIARSLCAIPDDDGLCFDPGSIAIEATREEAEYEGLRIRLTAHLGRSRCHVQWDVGFGDAVTPPPPEIAY
PVMLDGFPLPCLHVYPRETVFAEKLEAIAALGIANSRMKDFFDLLALVREDAMDRPHLVAAIGATFDRRRTPAPPPLPYG
LTQSFAADTQKQTQWRAFLRRNRLIAPDLSSVIAEIADYLDTLDTTVQS
Download Length: 870 bp
Antitoxin
Download Length: 201 a.a. Molecular weight: 22331.07 Da Isoelectric Point: 11.2557
>AT292504 WP_032966430.1 NZ_LS483406:c688712-688110 [Stenotrophomonas maltophilia]
MGNAEANARKLLRRAGTLRARELVTAGIARAQLTRLVEAGALIRLSRGVYALAERNSDDTDDGLRIIAERLPHPRLCLLS
ALRLHGLTTQAPFERWVSIGNSDRVPRIDWPPLRVVRMSAKTLNAGLEERRVGKRLIYVSNVAKTVVDCFKFRNLVGLDV
AIEALRDALHSRATTPDALMEYARICRVARLMRPYLDALA
MGNAEANARKLLRRAGTLRARELVTAGIARAQLTRLVEAGALIRLSRGVYALAERNSDDTDDGLRIIAERLPHPRLCLLS
ALRLHGLTTQAPFERWVSIGNSDRVPRIDWPPLRVVRMSAKTLNAGLEERRVGKRLIYVSNVAKTVVDCFKFRNLVGLDV
AIEALRDALHSRATTPDALMEYARICRVARLMRPYLDALA
Download Length: 603 bp