Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 263243..263891 | Replicon | chromosome |
Accession | NZ_LS483406 | ||
Organism | Stenotrophomonas maltophilia strain NCTC10498 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | DQN96_RS01215 | Protein ID | WP_005407702.1 |
Coordinates | 263243..263548 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | DQN96_RS01220 | Protein ID | WP_005407703.1 |
Coordinates | 263589..263891 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN96_RS01180 | 258529..259377 | + | 849 | WP_062606017.1 | SPOR domain-containing protein | - |
DQN96_RS01195 | 259971..260642 | - | 672 | WP_005407700.1 | hypothetical protein | - |
DQN96_RS01200 | 260733..262238 | - | 1506 | WP_005407701.1 | hypothetical protein | - |
DQN96_RS01215 | 263243..263548 | + | 306 | WP_005407702.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN96_RS01220 | 263589..263891 | + | 303 | WP_005407703.1 | putative addiction module antidote protein | Antitoxin |
DQN96_RS01225 | 264126..264448 | - | 323 | Protein_237 | hypothetical protein | - |
DQN96_RS01230 | 264529..264936 | - | 408 | WP_043035194.1 | hypothetical protein | - |
DQN96_RS01235 | 265531..266301 | + | 771 | WP_005411960.1 | DUF3011 domain-containing protein | - |
DQN96_RS01240 | 266326..266673 | - | 348 | WP_005411961.1 | hypothetical protein | - |
DQN96_RS01245 | 266804..267724 | + | 921 | WP_100438271.1 | arginase | - |
DQN96_RS01250 | 267885..268022 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
DQN96_RS01255 | 268229..268450 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11444.15 Da Isoelectric Point: 10.9897
>T292503 WP_005407702.1 NZ_LS483406:263243-263548 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|