Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1555180..1555792 Replicon chromosome
Accession NZ_LS483401
Organism Streptococcus pyogenes strain NCTC10085

Toxin (Protein)


Gene name parE Uniprot ID Q1JJZ2
Locus tag DQM79_RS07935 Protein ID WP_002988077.1
Coordinates 1555457..1555792 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQM79_RS07930 Protein ID WP_002988079.1
Coordinates 1555180..1555467 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM79_RS07905 1550371..1551354 - 984 WP_002988088.1 tagatose-bisphosphate aldolase -
DQM79_RS07910 1551358..1552287 - 930 WP_002988085.1 tagatose-6-phosphate kinase -
DQM79_RS07915 1552333..1552848 - 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
DQM79_RS07920 1552883..1553311 - 429 WP_002982747.1 galactose-6-phosphate isomerase subunit LacA -
DQM79_RS07925 1553757..1554530 + 774 WP_002982738.1 DeoR/GlpR family DNA-binding transcription regulator -
DQM79_RS07930 1555180..1555467 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQM79_RS07935 1555457..1555792 + 336 WP_002988077.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM79_RS09215 1555944..1556414 + 471 WP_002988074.1 integrase -
DQM79_RS09220 1556377..1556739 + 363 WP_180373113.1 tyrosine-type recombinase/integrase -
DQM79_RS09225 1556775..1556924 + 150 WP_002982720.1 hypothetical protein -
DQM79_RS07945 1557044..1557436 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQM79_RS07950 1557457..1557903 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQM79_RS07955 1558121..1558327 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
DQM79_RS07960 1558324..1558830 - 507 WP_002988070.1 hypothetical protein -
DQM79_RS07965 1558966..1559826 - 861 WP_002982687.1 DegV family protein -
DQM79_RS07970 1559923..1560441 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13117.83 Da        Isoelectric Point: 5.2144

>T292501 WP_002988077.1 NZ_LS483401:1555457-1555792 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292501 WP_002988079.1 NZ_LS483401:1555180-1555467 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A236

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References