Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1584027..1584639 | Replicon | chromosome |
Accession | NZ_LS483399 | ||
Organism | Streptococcus pyogenes strain NCTC8227 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4Z2JY48 |
Locus tag | DQM80_RS08210 | Protein ID | WP_002982731.1 |
Coordinates | 1584304..1584639 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A5S4TJ53 |
Locus tag | DQM80_RS08205 | Protein ID | WP_011055007.1 |
Coordinates | 1584027..1584314 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM80_RS08180 | 1579215..1580198 | - | 984 | WP_111702287.1 | tagatose-bisphosphate aldolase | - |
DQM80_RS08185 | 1580202..1581135 | - | 934 | Protein_1530 | tagatose-6-phosphate kinase | - |
DQM80_RS08190 | 1581181..1581696 | - | 516 | WP_030127321.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM80_RS08195 | 1581731..1582159 | - | 429 | WP_111702288.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM80_RS08200 | 1582604..1583377 | + | 774 | WP_111702289.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM80_RS08205 | 1584027..1584314 | + | 288 | WP_011055007.1 | hypothetical protein | Antitoxin |
DQM80_RS08210 | 1584304..1584639 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM80_RS09445 | 1584706..1585777 | + | 1072 | Protein_1536 | site-specific integrase | - |
DQM80_RS08235 | 1585909..1586301 | - | 393 | WP_111702290.1 | 30S ribosomal protein S9 | - |
DQM80_RS08240 | 1586322..1586768 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM80_RS08245 | 1586986..1587192 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM80_RS08250 | 1587189..1587887 | - | 699 | WP_063632128.1 | hypothetical protein | - |
DQM80_RS08255 | 1588014..1588874 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQM80_RS08260 | 1588971..1589489 | - | 519 | WP_011055010.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292500 WP_002982731.1 NZ_LS483399:1584304-1584639 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z2JY48 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5S4TJ53 |