Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 5390557..5391121 | Replicon | chromosome |
Accession | NZ_LS483395 | ||
Organism | Achromobacter xylosoxidans strain NCTC10808 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D6IHV7 |
Locus tag | DQO23_RS24655 | Protein ID | WP_020926667.1 |
Coordinates | 5390557..5390838 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0D6IHW1 |
Locus tag | DQO23_RS24660 | Protein ID | WP_020926666.1 |
Coordinates | 5390825..5391121 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQO23_RS24630 | 5385589..5386092 | - | 504 | WP_006386642.1 | flavin reductase family protein | - |
DQO23_RS24635 | 5386115..5387128 | - | 1014 | WP_024070172.1 | LLM class flavin-dependent oxidoreductase | - |
DQO23_RS24640 | 5387250..5388083 | + | 834 | WP_024070173.1 | IclR family transcriptional regulator | - |
DQO23_RS24645 | 5388319..5389374 | + | 1056 | WP_054442897.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
DQO23_RS24650 | 5389371..5390507 | + | 1137 | WP_024070175.1 | tRNA guanosine(34) transglycosylase Tgt | - |
DQO23_RS24655 | 5390557..5390838 | - | 282 | WP_020926667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQO23_RS24660 | 5390825..5391121 | - | 297 | WP_020926666.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DQO23_RS24665 | 5391493..5391837 | + | 345 | WP_006386647.1 | preprotein translocase subunit YajC | - |
DQO23_RS24670 | 5391953..5393833 | + | 1881 | WP_006386648.1 | protein translocase subunit SecD | - |
DQO23_RS24675 | 5393885..5394820 | + | 936 | WP_006386649.1 | protein translocase subunit SecF | - |
DQO23_RS24680 | 5394990..5395358 | + | 369 | WP_006386650.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DQO23_RS24685 | 5395355..5395666 | + | 312 | WP_006386651.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10262.77 Da Isoelectric Point: 7.0080
>T292496 WP_020926667.1 NZ_LS483395:c5390838-5390557 [Achromobacter xylosoxidans]
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
VPAVEWSSAARADLLAIVDYISDDNPDAAQRLKDDIETKAAQLPARPALYRPGRIAGTREMVVRANYIIVYAADALAVRI
LRILHAAQQWPPQ
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6IHV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6IHW1 |