Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 4333792..4334333 | Replicon | chromosome |
Accession | NZ_LS483395 | ||
Organism | Achromobacter xylosoxidans strain NCTC10808 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | DQO23_RS19850 | Protein ID | WP_026384571.1 |
Coordinates | 4333792..4334067 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | DQO23_RS19855 | Protein ID | WP_024069590.1 |
Coordinates | 4334067..4334333 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQO23_RS19830 | 4329744..4330667 | + | 924 | WP_006385014.1 | ABC transporter permease | - |
DQO23_RS19835 | 4330673..4331539 | + | 867 | WP_024069588.1 | ABC transporter permease | - |
DQO23_RS19840 | 4331597..4333336 | + | 1740 | WP_024069589.1 | hypothetical protein | - |
DQO23_RS19845 | 4333349..4333786 | + | 438 | WP_020928528.1 | acetyltransferase | - |
DQO23_RS19850 | 4333792..4334067 | - | 276 | WP_026384571.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQO23_RS19855 | 4334067..4334333 | - | 267 | WP_024069590.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
DQO23_RS19860 | 4334580..4335107 | + | 528 | WP_024069591.1 | sigma-70 family RNA polymerase sigma factor | - |
DQO23_RS19865 | 4335193..4336149 | + | 957 | WP_054498804.1 | FecR domain-containing protein | - |
DQO23_RS19870 | 4336409..4338835 | + | 2427 | WP_070543066.1 | TonB-dependent receptor | - |
DQO23_RS19875 | 4338888..4339094 | - | 207 | WP_006385007.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10710.42 Da Isoelectric Point: 10.4170
>T292495 WP_026384571.1 NZ_LS483395:c4334067-4333792 [Achromobacter xylosoxidans]
MEMKWTSKALSDLARLHEFLAAVNRPAAVRAVQALVKASSVLPTNSRIGEQLFQFEPREVRRILVGEYEIRYEIRDSIIY
VLRLWHTRENR
MEMKWTSKALSDLARLHEFLAAVNRPAAVRAVQALVKASSVLPTNSRIGEQLFQFEPREVRRILVGEYEIRYEIRDSIIY
VLRLWHTRENR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|