Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 1185817..1186859 | Replicon | chromosome |
| Accession | NZ_LS483395 | ||
| Organism | Achromobacter xylosoxidans strain NCTC10808 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | DQO23_RS05530 | Protein ID | WP_003153636.1 |
| Coordinates | 1185817..1186392 (-) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | DQO23_RS05535 | Protein ID | WP_003050245.1 |
| Coordinates | 1186389..1186859 (-) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQO23_RS05505 | 1182255..1182980 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
| DQO23_RS05510 | 1183019..1183921 | - | 903 | WP_003090158.1 | nucleotidyltransferase domain-containing protein | - |
| DQO23_RS05515 | 1183921..1184421 | - | 501 | WP_003090159.1 | hypothetical protein | - |
| DQO23_RS05520 | 1184418..1184888 | - | 471 | WP_003090160.1 | hypothetical protein | - |
| DQO23_RS05525 | 1184885..1185799 | - | 915 | WP_016852809.1 | AAA family ATPase | - |
| DQO23_RS05530 | 1185817..1186392 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| DQO23_RS05535 | 1186389..1186859 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DQO23_RS05540 | 1187063..1187446 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| DQO23_RS05545 | 1187443..1187676 | + | 234 | WP_006226027.1 | TIGR03758 family integrating conjugative element protein | - |
| DQO23_RS05550 | 1187693..1188052 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| DQO23_RS05555 | 1188064..1188462 | + | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
| DQO23_RS05560 | 1188459..1189151 | + | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
| DQO23_RS05565 | 1189148..1190059 | + | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
| DQO23_RS05570 | 1190049..1191467 | + | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T292494 WP_003153636.1 NZ_LS483395:c1186392-1185817 [Achromobacter xylosoxidans]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT292494 WP_003050245.1 NZ_LS483395:c1186859-1186389 [Achromobacter xylosoxidans]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|