Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1077094..1077667 | Replicon | chromosome |
Accession | NZ_LS483395 | ||
Organism | Achromobacter xylosoxidans strain NCTC10808 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DQO23_RS04950 | Protein ID | WP_111727627.1 |
Coordinates | 1077290..1077667 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DQO23_RS04945 | Protein ID | WP_054471260.1 |
Coordinates | 1077094..1077303 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQO23_RS04925 | 1072500..1073288 | - | 789 | WP_024067852.1 | helix-turn-helix transcriptional regulator | - |
DQO23_RS04930 | 1073387..1074313 | + | 927 | WP_020924995.1 | DMT family transporter | - |
DQO23_RS04935 | 1074326..1075144 | - | 819 | WP_058207221.1 | AAC(3) family N-acetyltransferase | - |
DQO23_RS04940 | 1075296..1076969 | + | 1674 | WP_024067854.1 | energy-dependent translational throttle protein EttA | - |
DQO23_RS04945 | 1077094..1077303 | + | 210 | WP_054471260.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
DQO23_RS04950 | 1077290..1077667 | + | 378 | WP_111727627.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DQO23_RS04955 | 1077735..1078268 | + | 534 | WP_024067855.1 | isochorismatase family protein | - |
DQO23_RS04960 | 1078459..1078683 | + | 225 | WP_006388976.1 | glycine zipper 2TM domain-containing protein | - |
DQO23_RS04965 | 1078813..1079070 | - | 258 | WP_006388977.1 | cell division topological specificity factor MinE | - |
DQO23_RS04970 | 1079074..1079889 | - | 816 | WP_006388978.1 | septum site-determining protein MinD | - |
DQO23_RS04975 | 1080078..1080995 | - | 918 | WP_024067857.1 | septum site-determining protein MinC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13876.14 Da Isoelectric Point: 6.3721
>T292493 WP_111727627.1 NZ_LS483395:1077290-1077667 [Achromobacter xylosoxidans]
MILVDTSIWIDHLSDGEPCLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGTMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
MILVDTSIWIDHLSDGEPCLVRLLEEESVLMHPFIAGELALGSLGRRDVVLGTMSLLPQVVRASHDEVMHFLHSERLFGK
GIGYVDLHLLASTRLTPGAALWTRDKRLQALATTLSLAVDPPRYH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|