Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1531214..1531826 | Replicon | chromosome |
Accession | NZ_LS483394 | ||
Organism | Streptococcus pyogenes strain NCTC10880 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4Z2JY48 |
Locus tag | DQM37_RS07765 | Protein ID | WP_002982731.1 |
Coordinates | 1531491..1531826 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQM37_RS07760 | Protein ID | WP_002988079.1 |
Coordinates | 1531214..1531501 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM37_RS07735 | 1526403..1527386 | - | 984 | WP_014407847.1 | tagatose-bisphosphate aldolase | - |
DQM37_RS07740 | 1527390..1528319 | - | 930 | WP_111694976.1 | tagatose-6-phosphate kinase | - |
DQM37_RS07745 | 1528367..1528882 | - | 516 | WP_014407849.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM37_RS07750 | 1528917..1529345 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM37_RS07755 | 1529791..1530564 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM37_RS07760 | 1531214..1531501 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQM37_RS07765 | 1531491..1531826 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM37_RS09145 | 1531978..1532448 | + | 471 | Protein_1424 | tyrosine-type recombinase/integrase family protein | - |
DQM37_RS07780 | 1532562..1532960 | + | 399 | WP_197711562.1 | tyrosine-type recombinase/integrase | - |
DQM37_RS07785 | 1533093..1533485 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQM37_RS07790 | 1533506..1533952 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM37_RS07795 | 1534170..1534376 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM37_RS07800 | 1534373..1535071 | - | 699 | WP_172451603.1 | hypothetical protein | - |
DQM37_RS07805 | 1535207..1536067 | - | 861 | WP_011529009.1 | DegV family protein | - |
DQM37_RS07810 | 1536164..1536682 | - | 519 | WP_111694979.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292491 WP_002982731.1 NZ_LS483394:1531491-1531826 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z2JY48 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |