Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1572540..1573184 | Replicon | chromosome |
| Accession | NZ_LS483392 | ||
| Organism | Haemophilus influenzae strain NCTC11931 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q4QKY0 |
| Locus tag | DQM65_RS08115 | Protein ID | WP_005643265.1 |
| Coordinates | 1572540..1572725 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q4QKX9 |
| Locus tag | DQM65_RS08120 | Protein ID | WP_005692602.1 |
| Coordinates | 1572756..1573184 (+) | Length | 143 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM65_RS08065 | 1568614..1569135 | - | 522 | WP_005654597.1 | hypothetical protein | - |
| DQM65_RS08070 | 1569213..1569464 | + | 252 | WP_005643377.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DQM65_RS08075 | 1569448..1569795 | + | 348 | WP_005654594.1 | helix-turn-helix domain-containing protein | - |
| DQM65_RS08080 | 1569797..1570078 | - | 282 | WP_111691733.1 | hypothetical protein | - |
| DQM65_RS08085 | 1569990..1570325 | - | 336 | WP_103757470.1 | DUF2570 family protein | - |
| DQM65_RS08090 | 1570298..1570840 | - | 543 | WP_042594014.1 | lysozyme | - |
| DQM65_RS08095 | 1570821..1571072 | - | 252 | WP_005688862.1 | hypothetical protein | - |
| DQM65_RS08105 | 1571329..1571838 | - | 510 | WP_105872415.1 | antitermination protein | - |
| DQM65_RS08110 | 1571839..1572384 | - | 546 | WP_005668550.1 | recombination protein NinG | - |
| DQM65_RS08115 | 1572540..1572725 | + | 186 | WP_005643265.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| DQM65_RS08120 | 1572756..1573184 | + | 429 | WP_005692602.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| DQM65_RS08125 | 1573185..1573694 | - | 510 | WP_005692600.1 | DUF1367 family protein | - |
| DQM65_RS08130 | 1573699..1574289 | - | 591 | WP_111691734.1 | adenine methyltransferase | - |
| DQM65_RS08135 | 1574286..1574912 | - | 627 | WP_111691735.1 | replication P | - |
| DQM65_RS08140 | 1574909..1575631 | - | 723 | WP_111691736.1 | helix-turn-helix domain-containing protein | - |
| DQM65_RS08145 | 1575628..1576302 | - | 675 | WP_044365078.1 | phage regulatory protein/antirepressor Ant | - |
| DQM65_RS08150 | 1576351..1576791 | - | 441 | WP_048942423.1 | hypothetical protein | - |
| DQM65_RS08155 | 1576846..1577085 | - | 240 | WP_005688828.1 | hypothetical protein | - |
| DQM65_RS08160 | 1577186..1577851 | + | 666 | WP_105182817.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1541988..1590958 | 48970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6716.88 Da Isoelectric Point: 11.1595
>T292489 WP_005643265.1 NZ_LS483392:1572540-1572725 [Haemophilus influenzae]
MRSSDLIKELKSAGCTFVRHGKGDHQIWQSPITGKTFPVPHPKQHVPIGTLRSIKKSAGLL
MRSSDLIKELKSAGCTFVRHGKGDHQIWQSPITGKTFPVPHPKQHVPIGTLRSIKKSAGLL
Download Length: 186 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 16458.45 Da Isoelectric Point: 4.3241
>AT292489 WP_005692602.1 NZ_LS483392:1572756-1573184 [Haemophilus influenzae]
MLFTIGIETPTNENEAYGITVPALFTEEYSCFSAADTLEEIPTQVTDAIHSILEMMFEDGIDINELQDKGYRHYQTQEDF
NYCDTWLLLDVDISAYQGKRHRINISLPEYLIKRIDSRVASNPIYKDRSHFLAIASQKELRQ
MLFTIGIETPTNENEAYGITVPALFTEEYSCFSAADTLEEIPTQVTDAIHSILEMMFEDGIDINELQDKGYRHYQTQEDF
NYCDTWLLLDVDISAYQGKRHRINISLPEYLIKRIDSRVASNPIYKDRSHFLAIASQKELRQ
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|