Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1572540..1573184 Replicon chromosome
Accession NZ_LS483392
Organism Haemophilus influenzae strain NCTC11931

Toxin (Protein)


Gene name hicA Uniprot ID Q4QKY0
Locus tag DQM65_RS08115 Protein ID WP_005643265.1
Coordinates 1572540..1572725 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q4QKX9
Locus tag DQM65_RS08120 Protein ID WP_005692602.1
Coordinates 1572756..1573184 (+) Length 143 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM65_RS08065 1568614..1569135 - 522 WP_005654597.1 hypothetical protein -
DQM65_RS08070 1569213..1569464 + 252 WP_005643377.1 type II toxin-antitoxin system RelE/ParE family toxin -
DQM65_RS08075 1569448..1569795 + 348 WP_005654594.1 helix-turn-helix domain-containing protein -
DQM65_RS08080 1569797..1570078 - 282 WP_111691733.1 hypothetical protein -
DQM65_RS08085 1569990..1570325 - 336 WP_103757470.1 DUF2570 family protein -
DQM65_RS08090 1570298..1570840 - 543 WP_042594014.1 lysozyme -
DQM65_RS08095 1570821..1571072 - 252 WP_005688862.1 hypothetical protein -
DQM65_RS08105 1571329..1571838 - 510 WP_105872415.1 antitermination protein -
DQM65_RS08110 1571839..1572384 - 546 WP_005668550.1 recombination protein NinG -
DQM65_RS08115 1572540..1572725 + 186 WP_005643265.1 type II toxin-antitoxin system HicA family toxin Toxin
DQM65_RS08120 1572756..1573184 + 429 WP_005692602.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
DQM65_RS08125 1573185..1573694 - 510 WP_005692600.1 DUF1367 family protein -
DQM65_RS08130 1573699..1574289 - 591 WP_111691734.1 adenine methyltransferase -
DQM65_RS08135 1574286..1574912 - 627 WP_111691735.1 replication P -
DQM65_RS08140 1574909..1575631 - 723 WP_111691736.1 helix-turn-helix domain-containing protein -
DQM65_RS08145 1575628..1576302 - 675 WP_044365078.1 phage regulatory protein/antirepressor Ant -
DQM65_RS08150 1576351..1576791 - 441 WP_048942423.1 hypothetical protein -
DQM65_RS08155 1576846..1577085 - 240 WP_005688828.1 hypothetical protein -
DQM65_RS08160 1577186..1577851 + 666 WP_105182817.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1541988..1590958 48970


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-134)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6716.88 Da        Isoelectric Point: 11.1595

>T292489 WP_005643265.1 NZ_LS483392:1572540-1572725 [Haemophilus influenzae]
MRSSDLIKELKSAGCTFVRHGKGDHQIWQSPITGKTFPVPHPKQHVPIGTLRSIKKSAGLL

Download         Length: 186 bp

Antitoxin


Download         Length: 143 a.a.        Molecular weight: 16458.45 Da        Isoelectric Point: 4.3241

>AT292489 WP_005692602.1 NZ_LS483392:1572756-1573184 [Haemophilus influenzae]
MLFTIGIETPTNENEAYGITVPALFTEEYSCFSAADTLEEIPTQVTDAIHSILEMMFEDGIDINELQDKGYRHYQTQEDF
NYCDTWLLLDVDISAYQGKRHRINISLPEYLIKRIDSRVASNPIYKDRSHFLAIASQKELRQ

Download         Length: 429 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q4QKY0

Antitoxin

Source ID Structure
AlphaFold DB Q4QKX9

References