Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 751993..752630 | Replicon | chromosome |
| Accession | NZ_LS483392 | ||
| Organism | Haemophilus influenzae strain NCTC11931 | ||
Toxin (Protein)
| Gene name | VapC1 | Uniprot ID | - |
| Locus tag | DQM65_RS03905 | Protein ID | WP_101160683.1 |
| Coordinates | 752226..752630 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | VapB1 | Uniprot ID | A0A0H3PN67 |
| Locus tag | DQM65_RS03900 | Protein ID | WP_005656316.1 |
| Coordinates | 751993..752229 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM65_RS03875 | 747370..748110 | - | 741 | WP_005662961.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| DQM65_RS03880 | 748123..748596 | - | 474 | WP_172454808.1 | dihydroneopterin triphosphate diphosphatase | - |
| DQM65_RS03885 | 748618..750384 | - | 1767 | WP_111691294.1 | aspartate--tRNA ligase | - |
| DQM65_RS03890 | 750603..751121 | + | 519 | WP_005688985.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| DQM65_RS03895 | 751175..751900 | + | 726 | WP_044332436.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
| DQM65_RS03900 | 751993..752229 | + | 237 | WP_005656316.1 | antitoxin | Antitoxin |
| DQM65_RS03905 | 752226..752630 | + | 405 | WP_101160683.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DQM65_RS03910 | 752697..753104 | + | 408 | WP_005628548.1 | lactoylglutathione lyase | - |
| DQM65_RS03915 | 753178..753867 | + | 690 | WP_005686760.1 | ribonuclease T | - |
| DQM65_RS03920 | 754181..755533 | + | 1353 | WP_111691295.1 | Na+/H+ antiporter family protein | - |
| DQM65_RS03925 | 755566..756150 | + | 585 | WP_111691296.1 | primosomal replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15551.12 Da Isoelectric Point: 8.9778
>T292486 WP_101160683.1 NZ_LS483392:752226-752630 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWASTLKKQGQPIGNNDLWIACHALSLNAVLITHNVKGFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWASTLKKQGQPIGNNDLWIACHALSLNAVLITHNVKGFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|