Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 677575..678109 | Replicon | chromosome |
| Accession | NZ_LS483392 | ||
| Organism | Haemophilus influenzae strain NCTC11931 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0M1GMI0 |
| Locus tag | DQM65_RS03480 | Protein ID | WP_012054909.1 |
| Coordinates | 677575..677865 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0M1GP19 |
| Locus tag | DQM65_RS03485 | Protein ID | WP_032823666.1 |
| Coordinates | 677855..678109 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM65_RS03445 | 672696..673481 | - | 786 | WP_111691251.1 | energy transducer TonB | - |
| DQM65_RS03450 | 673491..673934 | - | 444 | WP_005656183.1 | TonB system transport protein ExbD | - |
| DQM65_RS03455 | 673938..674390 | - | 453 | WP_005660631.1 | TonB-system energizer ExbB | - |
| DQM65_RS03460 | 674533..675000 | - | 468 | WP_005660632.1 | thioredoxin-dependent thiol peroxidase | - |
| DQM65_RS03465 | 675101..675997 | + | 897 | WP_005692198.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| DQM65_RS03470 | 676109..676756 | + | 648 | WP_111691252.1 | outer membrane protein assembly factor BamC | - |
| DQM65_RS03475 | 676929..677252 | + | 324 | WP_005648863.1 | ribosome-associated translation inhibitor RaiA | - |
| DQM65_RS03480 | 677575..677865 | - | 291 | WP_012054909.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM65_RS03485 | 677855..678109 | - | 255 | WP_032823666.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DQM65_RS03490 | 678591..680798 | - | 2208 | WP_111691253.1 | DUF927 domain-containing protein | - |
| DQM65_RS03495 | 680808..681086 | - | 279 | WP_111691254.1 | hypothetical protein | - |
| DQM65_RS03500 | 681095..681280 | - | 186 | WP_032823663.1 | hypothetical protein | - |
| DQM65_RS03505 | 681277..681516 | - | 240 | WP_105882311.1 | hypothetical protein | - |
| DQM65_RS03510 | 681509..682099 | - | 591 | WP_111691255.1 | host cell division inhibitor Icd-like protein | - |
| DQM65_RS03515 | 682159..682389 | - | 231 | WP_012054915.1 | hypothetical protein | - |
| DQM65_RS03520 | 682370..682585 | - | 216 | WP_111691256.1 | AlpA family phage regulatory protein | - |
| DQM65_RS03525 | 682628..682855 | - | 228 | WP_111691257.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11237.15 Da Isoelectric Point: 10.4256
>T292485 WP_012054909.1 NZ_LS483392:c677865-677575 [Haemophilus influenzae]
MTYKLTFSPKAKKEWDKLGDTIKNQFKKKLLERLENPHVPADRLSGFSGVFYKIKLRSVGYRLVYEVIEDKVIVYVLAVG
KRERAEVYTAARDRLN
MTYKLTFSPKAKKEWDKLGDTIKNQFKKKLLERLENPHVPADRLSGFSGVFYKIKLRSVGYRLVYEVIEDKVIVYVLAVG
KRERAEVYTAARDRLN
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M1GMI0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M1GP19 |