Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 677575..678109 Replicon chromosome
Accession NZ_LS483392
Organism Haemophilus influenzae strain NCTC11931

Toxin (Protein)


Gene name relE Uniprot ID A0A0M1GMI0
Locus tag DQM65_RS03480 Protein ID WP_012054909.1
Coordinates 677575..677865 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0M1GP19
Locus tag DQM65_RS03485 Protein ID WP_032823666.1
Coordinates 677855..678109 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM65_RS03445 672696..673481 - 786 WP_111691251.1 energy transducer TonB -
DQM65_RS03450 673491..673934 - 444 WP_005656183.1 TonB system transport protein ExbD -
DQM65_RS03455 673938..674390 - 453 WP_005660631.1 TonB-system energizer ExbB -
DQM65_RS03460 674533..675000 - 468 WP_005660632.1 thioredoxin-dependent thiol peroxidase -
DQM65_RS03465 675101..675997 + 897 WP_005692198.1 4-hydroxy-tetrahydrodipicolinate synthase -
DQM65_RS03470 676109..676756 + 648 WP_111691252.1 outer membrane protein assembly factor BamC -
DQM65_RS03475 676929..677252 + 324 WP_005648863.1 ribosome-associated translation inhibitor RaiA -
DQM65_RS03480 677575..677865 - 291 WP_012054909.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM65_RS03485 677855..678109 - 255 WP_032823666.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DQM65_RS03490 678591..680798 - 2208 WP_111691253.1 DUF927 domain-containing protein -
DQM65_RS03495 680808..681086 - 279 WP_111691254.1 hypothetical protein -
DQM65_RS03500 681095..681280 - 186 WP_032823663.1 hypothetical protein -
DQM65_RS03505 681277..681516 - 240 WP_105882311.1 hypothetical protein -
DQM65_RS03510 681509..682099 - 591 WP_111691255.1 host cell division inhibitor Icd-like protein -
DQM65_RS03515 682159..682389 - 231 WP_012054915.1 hypothetical protein -
DQM65_RS03520 682370..682585 - 216 WP_111691256.1 AlpA family phage regulatory protein -
DQM65_RS03525 682628..682855 - 228 WP_111691257.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11237.15 Da        Isoelectric Point: 10.4256

>T292485 WP_012054909.1 NZ_LS483392:c677865-677575 [Haemophilus influenzae]
MTYKLTFSPKAKKEWDKLGDTIKNQFKKKLLERLENPHVPADRLSGFSGVFYKIKLRSVGYRLVYEVIEDKVIVYVLAVG
KRERAEVYTAARDRLN

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9526.91 Da        Isoelectric Point: 4.1317

>AT292485 WP_032823666.1 NZ_LS483392:c678109-677855 [Haemophilus influenzae]
MAIHQILTEQAASITDLKRNPMGVMRESENGVIAILNRNQPAFYCLTPEMFAYMQELIEDAELVRIAEERKAEGGFIEVD
INDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M1GMI0

Antitoxin

Source ID Structure
AlphaFold DB A0A0M1GP19

References