Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 300374..300978 | Replicon | chromosome |
Accession | NZ_LS483392 | ||
Organism | Haemophilus influenzae strain NCTC11931 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | DQM65_RS01590 | Protein ID | WP_111691059.1 |
Coordinates | 300670..300978 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0Y7JSS2 |
Locus tag | DQM65_RS01585 | Protein ID | WP_005661259.1 |
Coordinates | 300374..300670 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM65_RS01570 | 296140..297525 | + | 1386 | WP_111691056.1 | L-seryl-tRNA(Sec) selenium transferase | - |
DQM65_RS01575 | 297522..299381 | + | 1860 | WP_111691057.1 | selenocysteine-specific translation elongation factor | - |
DQM65_RS01580 | 299400..300254 | + | 855 | WP_111691058.1 | DUF3298 domain-containing protein | - |
DQM65_RS01585 | 300374..300670 | + | 297 | WP_005661259.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DQM65_RS01590 | 300670..300978 | + | 309 | WP_111691059.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
DQM65_RS01595 | 301035..304196 | - | 3162 | WP_111691983.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11881.61 Da Isoelectric Point: 7.3187
>T292483 WP_111691059.1 NZ_LS483392:300670-300978 [Haemophilus influenzae]
MSEDKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
MSEDKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|