Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 212007..212671 | Replicon | chromosome |
Accession | NZ_LS483392 | ||
Organism | Haemophilus influenzae strain NCTC11931 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DQM65_RS01130 | Protein ID | WP_077583255.1 |
Coordinates | 212270..212671 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DQM65_RS01125 | Protein ID | WP_111691011.1 |
Coordinates | 212007..212270 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM65_RS01105 | 207689..208132 | + | 444 | WP_111691981.1 | TIGR03757 family integrating conjugative element protein | - |
DQM65_RS01110 | 208134..209054 | + | 921 | WP_111691008.1 | TIGR03756 family integrating conjugative element protein | - |
DQM65_RS01115 | 209065..211074 | + | 2010 | WP_111691009.1 | integrating conjugative element protein | - |
DQM65_RS01120 | 211141..211575 | + | 435 | WP_111691010.1 | hypothetical protein | - |
DQM65_RS10510 | 211690..211851 | + | 162 | WP_172454799.1 | hypothetical protein | - |
DQM65_RS01125 | 212007..212270 | + | 264 | WP_111691011.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DQM65_RS01130 | 212270..212671 | + | 402 | WP_077583255.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DQM65_RS01135 | 212699..213034 | + | 336 | WP_111691012.1 | hypothetical protein | - |
DQM65_RS01140 | 213105..214628 | - | 1524 | WP_111691013.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
DQM65_RS01145 | 214638..214940 | - | 303 | WP_111691014.1 | hypothetical protein | - |
DQM65_RS01150 | 214937..215332 | - | 396 | WP_111691015.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 192542..228956 | 36414 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15130.57 Da Isoelectric Point: 6.2184
>T292482 WP_077583255.1 NZ_LS483392:212270-212671 [Haemophilus influenzae]
MYMLDTNTVSDIVRKDPNVIRQLKSLSPESICISGITAAEIIYGLEKRQSTKLNQVMYPFLEVVTIYDWHYGVAQCYGKL
RAKMEKQGFVMGALDLMIAAHAVSENCTLVTSDNAFKMVPDLIIQNWREEHNI
MYMLDTNTVSDIVRKDPNVIRQLKSLSPESICISGITAAEIIYGLEKRQSTKLNQVMYPFLEVVTIYDWHYGVAQCYGKL
RAKMEKQGFVMGALDLMIAAHAVSENCTLVTSDNAFKMVPDLIIQNWREEHNI
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|