Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1588713..1589381 | Replicon | chromosome |
Accession | NZ_LS483390 | ||
Organism | Streptococcus pneumoniae strain NCTC13276 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | B1I7Q0 |
Locus tag | DQM93_RS08365 | Protein ID | WP_001132285.1 |
Coordinates | 1589202..1589381 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | DQM93_RS08360 | Protein ID | WP_000961810.1 |
Coordinates | 1588713..1589165 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM93_RS08335 | 1584603..1585346 | - | 744 | WP_001188203.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
DQM93_RS08340 | 1585348..1586298 | - | 951 | WP_000451131.1 | 50S ribosomal protein L11 methyltransferase | - |
DQM93_RS08345 | 1586436..1586864 | - | 429 | WP_000418176.1 | NUDIX hydrolase | - |
DQM93_RS08350 | 1586830..1587933 | - | 1104 | WP_000719717.1 | M50 family metallopeptidase | - |
DQM93_RS08355 | 1587952..1588422 | - | 471 | WP_000257105.1 | DUF3013 family protein | - |
DQM93_RS08360 | 1588713..1589165 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DQM93_RS08365 | 1589202..1589381 | - | 180 | WP_001132285.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DQM93_RS08370 | 1589518..1589697 | - | 180 | WP_001809903.1 | hypothetical protein | - |
DQM93_RS08380 | 1589862..1590101 | - | 240 | WP_000818079.1 | hypothetical protein | - |
DQM93_RS08390 | 1590371..1591642 | + | 1272 | WP_001113205.1 | replication-associated recombination protein A | - |
DQM93_RS08400 | 1592189..1593508 | - | 1320 | WP_000608887.1 | glycoside hydrolase family 32 protein | - |
DQM93_RS08405 | 1593518..1594363 | - | 846 | WP_000819520.1 | carbohydrate ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.01 Da Isoelectric Point: 11.2964
>T292479 WP_001132285.1 NZ_LS483390:c1589381-1589202 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT292479 WP_000961810.1 NZ_LS483390:c1589165-1588713 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9HEZ5 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5YRZ | |
AlphaFold DB | G0IC64 |