Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1654534..1655146 | Replicon | chromosome |
Accession | NZ_LS483389 | ||
Organism | Streptococcus pyogenes strain NCTC10879 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4Z2JY48 |
Locus tag | DQM81_RS08585 | Protein ID | WP_002982731.1 |
Coordinates | 1654811..1655146 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQM81_RS08580 | Protein ID | WP_002988079.1 |
Coordinates | 1654534..1654821 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM81_RS08555 | 1649726..1650709 | - | 984 | WP_020905487.1 | tagatose-bisphosphate aldolase | - |
DQM81_RS08560 | 1650713..1651642 | - | 930 | WP_020905488.1 | tagatose-6-phosphate kinase | - |
DQM81_RS08565 | 1651688..1652203 | - | 516 | WP_020905489.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM81_RS08570 | 1652238..1652666 | - | 429 | WP_053308614.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM81_RS08575 | 1653111..1653884 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM81_RS08580 | 1654534..1654821 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQM81_RS08585 | 1654811..1655146 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM81_RS09955 | 1655298..1655768 | + | 471 | Protein_1598 | integrase | - |
DQM81_RS08600 | 1655882..1656232 | + | 351 | WP_111679863.1 | tyrosine-type recombinase/integrase | - |
DQM81_RS08605 | 1656400..1656792 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQM81_RS08610 | 1656813..1657259 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM81_RS08615 | 1657477..1657683 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM81_RS08620 | 1657680..1658378 | - | 699 | WP_161237464.1 | hypothetical protein | - |
DQM81_RS08625 | 1658514..1659374 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQM81_RS08630 | 1659471..1659989 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292475 WP_002982731.1 NZ_LS483389:1654811-1655146 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z2JY48 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |