Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 242635..243247 | Replicon | chromosome |
| Accession | NZ_LS483387 | ||
| Organism | Streptococcus agalactiae strain NCTC8187 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q8E1X3 |
| Locus tag | DQM64_RS01420 | Protein ID | WP_000384858.1 |
| Coordinates | 242635..242970 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E1X2 |
| Locus tag | DQM64_RS01425 | Protein ID | WP_000255538.1 |
| Coordinates | 242960..243247 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM64_RS01390 | 237833..238474 | + | 642 | WP_000591144.1 | hypothetical protein | - |
| DQM64_RS01400 | 238774..239649 | + | 876 | WP_000421240.1 | hypothetical protein | - |
| DQM64_RS01405 | 239685..240119 | + | 435 | WP_001220479.1 | hypothetical protein | - |
| DQM64_RS01410 | 240436..241692 | + | 1257 | WP_000122836.1 | plasmid recombination protein | - |
| DQM64_RS01415 | 241860..242330 | + | 471 | WP_000130119.1 | hypothetical protein | - |
| DQM64_RS01420 | 242635..242970 | - | 336 | WP_000384858.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM64_RS01425 | 242960..243247 | - | 288 | WP_000255538.1 | hypothetical protein | Antitoxin |
| DQM64_RS01430 | 243754..244044 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| DQM64_RS01435 | 244146..244553 | + | 408 | WP_000749954.1 | hypothetical protein | - |
| DQM64_RS01440 | 244553..245113 | + | 561 | WP_001865562.1 | hypothetical protein | - |
| DQM64_RS01445 | 245086..245766 | + | 681 | WP_001865565.1 | hypothetical protein | - |
| DQM64_RS01450 | 245751..246137 | + | 387 | WP_000259069.1 | hypothetical protein | - |
| DQM64_RS01455 | 246171..246452 | + | 282 | WP_000052406.1 | hypothetical protein | - |
| DQM64_RS01475 | 247295..248155 | + | 861 | WP_000477654.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 234663..243521 | 8858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13264.04 Da Isoelectric Point: 5.2388
>T292473 WP_000384858.1 NZ_LS483387:c242970-242635 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1EF10 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1EFF9 |