Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1677745..1678357 Replicon chromosome
Accession NZ_LS483386
Organism Streptococcus pyogenes strain NCTC13742

Toxin (Protein)


Gene name parE Uniprot ID A0A4Z2JY48
Locus tag DQM82_RS08590 Protein ID WP_002982731.1
Coordinates 1678022..1678357 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQM82_RS08585 Protein ID WP_002988079.1
Coordinates 1677745..1678032 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM82_RS08560 1672923..1673906 - 984 WP_023611854.1 tagatose-bisphosphate aldolase -
DQM82_RS08565 1673910..1674839 - 930 WP_023611874.1 tagatose-6-phosphate kinase -
DQM82_RS08570 1674887..1675402 - 516 WP_014407849.1 galactose-6-phosphate isomerase subunit LacB -
DQM82_RS08575 1675437..1675865 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
DQM82_RS08580 1676311..1677084 + 774 WP_002993783.1 DeoR/GlpR family DNA-binding transcription regulator -
DQM82_RS08585 1677745..1678032 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQM82_RS08590 1678022..1678357 + 336 WP_002982731.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM82_RS09990 1678509..1678979 + 471 Protein_1576 tyrosine-type recombinase/integrase family protein -
DQM82_RS09995 1679341..1679442 + 102 WP_180372495.1 hypothetical protein -
DQM82_RS08615 1679622..1680014 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQM82_RS08620 1680035..1680481 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQM82_RS08625 1680699..1680905 - 207 WP_023611859.1 helix-turn-helix transcriptional regulator -
DQM82_RS08630 1680902..1681600 - 699 WP_023611871.1 hypothetical protein -
DQM82_RS08635 1681736..1682596 - 861 WP_023611214.1 DegV family protein -
DQM82_RS08640 1682693..1683211 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13145.88 Da        Isoelectric Point: 5.2144

>T292472 WP_002982731.1 NZ_LS483386:1678022-1678357 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292472 WP_002988079.1 NZ_LS483386:1677745-1678032 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Z2JY48

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References