Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1585312..1585924 Replicon chromosome
Accession NZ_LS483384
Organism Streptococcus pyogenes strain NCTC13743

Toxin (Protein)


Gene name parE Uniprot ID A0A4Z2JY48
Locus tag DQM87_RS08120 Protein ID WP_002982731.1
Coordinates 1585589..1585924 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQM87_RS08115 Protein ID WP_002988079.1
Coordinates 1585312..1585599 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM87_RS08090 1580493..1581476 - 984 WP_014407847.1 tagatose-bisphosphate aldolase -
DQM87_RS08095 1581480..1582409 - 930 WP_111705225.1 tagatose-6-phosphate kinase -
DQM87_RS08100 1582455..1582970 - 516 WP_020905489.1 galactose-6-phosphate isomerase subunit LacB -
DQM87_RS08105 1583005..1583433 - 429 WP_053308614.1 galactose-6-phosphate isomerase subunit LacA -
DQM87_RS08110 1583878..1584651 + 774 WP_111705226.1 DeoR/GlpR family DNA-binding transcription regulator -
DQM87_RS08115 1585312..1585599 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQM87_RS08120 1585589..1585924 + 336 WP_002982731.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM87_RS09510 1586076..1586546 + 471 Protein_1487 tyrosine-type recombinase/integrase family protein -
DQM87_RS08135 1586509..1587009 + 501 WP_111705227.1 site-specific integrase -
DQM87_RS08140 1587177..1587569 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQM87_RS08145 1587590..1588036 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQM87_RS08150 1588254..1588460 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
DQM87_RS08155 1588457..1589155 - 699 WP_168390597.1 hypothetical protein -
DQM87_RS08160 1589291..1590151 - 861 WP_002982687.1 DegV family protein -
DQM87_RS08165 1590248..1590766 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13145.88 Da        Isoelectric Point: 5.2144

>T292471 WP_002982731.1 NZ_LS483384:1585589-1585924 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292471 WP_002988079.1 NZ_LS483384:1585312-1585599 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Z2JY48

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References