Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1585312..1585924 | Replicon | chromosome |
| Accession | NZ_LS483384 | ||
| Organism | Streptococcus pyogenes strain NCTC13743 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A4Z2JY48 |
| Locus tag | DQM87_RS08120 | Protein ID | WP_002982731.1 |
| Coordinates | 1585589..1585924 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQM87_RS08115 | Protein ID | WP_002988079.1 |
| Coordinates | 1585312..1585599 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM87_RS08090 | 1580493..1581476 | - | 984 | WP_014407847.1 | tagatose-bisphosphate aldolase | - |
| DQM87_RS08095 | 1581480..1582409 | - | 930 | WP_111705225.1 | tagatose-6-phosphate kinase | - |
| DQM87_RS08100 | 1582455..1582970 | - | 516 | WP_020905489.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQM87_RS08105 | 1583005..1583433 | - | 429 | WP_053308614.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQM87_RS08110 | 1583878..1584651 | + | 774 | WP_111705226.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQM87_RS08115 | 1585312..1585599 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQM87_RS08120 | 1585589..1585924 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM87_RS09510 | 1586076..1586546 | + | 471 | Protein_1487 | tyrosine-type recombinase/integrase family protein | - |
| DQM87_RS08135 | 1586509..1587009 | + | 501 | WP_111705227.1 | site-specific integrase | - |
| DQM87_RS08140 | 1587177..1587569 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQM87_RS08145 | 1587590..1588036 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQM87_RS08150 | 1588254..1588460 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQM87_RS08155 | 1588457..1589155 | - | 699 | WP_168390597.1 | hypothetical protein | - |
| DQM87_RS08160 | 1589291..1590151 | - | 861 | WP_002982687.1 | DegV family protein | - |
| DQM87_RS08165 | 1590248..1590766 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292471 WP_002982731.1 NZ_LS483384:1585589-1585924 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Z2JY48 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |