Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1596930..1597542 | Replicon | chromosome |
| Accession | NZ_LS483382 | ||
| Organism | Streptococcus pyogenes strain NCTC13738 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQM89_RS08290 | Protein ID | WP_014635711.1 |
| Coordinates | 1597207..1597542 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQM89_RS08285 | Protein ID | WP_002988079.1 |
| Coordinates | 1596930..1597217 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM89_RS08260 | 1592118..1593101 | - | 984 | WP_076634369.1 | tagatose-bisphosphate aldolase | - |
| DQM89_RS08265 | 1593105..1594034 | - | 930 | WP_076634370.1 | tagatose-6-phosphate kinase | - |
| DQM89_RS08270 | 1594084..1594599 | - | 516 | WP_014407849.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQM89_RS08275 | 1594634..1595062 | - | 429 | WP_014635709.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQM89_RS08280 | 1595507..1596280 | + | 774 | WP_023605292.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQM89_RS08285 | 1596930..1597217 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQM89_RS08290 | 1597207..1597542 | + | 336 | WP_014635711.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM89_RS09630 | 1597694..1598116 | + | 423 | Protein_1526 | integrase | - |
| DQM89_RS09635 | 1598512..1598613 | + | 102 | WP_186786566.1 | hypothetical protein | - |
| DQM89_RS08305 | 1598782..1599174 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQM89_RS08310 | 1599195..1599641 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQM89_RS08315 | 1599859..1600065 | - | 207 | WP_076634371.1 | helix-turn-helix transcriptional regulator | - |
| DQM89_RS08320 | 1600062..1600760 | - | 699 | WP_168643110.1 | hypothetical protein | - |
| DQM89_RS08325 | 1600896..1601756 | - | 861 | WP_076634373.1 | DegV family protein | - |
| DQM89_RS08330 | 1601853..1602371 | - | 519 | WP_076634374.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13173.94 Da Isoelectric Point: 5.6809
>T292469 WP_014635711.1 NZ_LS483382:1597207-1597542 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|