Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 804502..805073 | Replicon | chromosome |
Accession | NZ_LS483381 | ||
Organism | Streptococcus sobrinus strain NCTC10921 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U2J9M5 |
Locus tag | DQM69_RS03965 | Protein ID | WP_021673296.1 |
Coordinates | 804502..804834 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | U2KH30 |
Locus tag | DQM69_RS03970 | Protein ID | WP_002959726.1 |
Coordinates | 804828..805073 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM69_RS03950 | 799977..801590 | + | 1614 | WP_109982536.1 | alpha-glucosidase | - |
DQM69_RS03955 | 802139..802648 | + | 510 | WP_019779284.1 | DinB family protein | - |
DQM69_RS03960 | 802669..804018 | + | 1350 | WP_109982537.1 | replication-associated recombination protein A | - |
DQM69_RS03965 | 804502..804834 | - | 333 | WP_021673296.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQM69_RS03970 | 804828..805073 | - | 246 | WP_002959726.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DQM69_RS03975 | 805224..805988 | - | 765 | WP_019769317.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM69_RS03980 | 806248..806676 | + | 429 | WP_002959730.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM69_RS03985 | 806704..807219 | + | 516 | WP_002959732.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM69_RS03990 | 807359..808339 | + | 981 | WP_019795477.1 | tagatose-bisphosphate aldolase | - |
DQM69_RS03995 | 808617..809450 | + | 834 | WP_109982538.1 | PRD domain-containing protein | - |
DQM69_RS04000 | 809487..809801 | + | 315 | WP_002959739.1 | PTS lactose/cellobiose transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12602.63 Da Isoelectric Point: 9.3092
>T292467 WP_021673296.1 NZ_LS483381:c804834-804502 [Streptococcus sobrinus]
MVEIKQGTIIKINLDPKEGHEQRGYRPYVCLSHSVVQNYSNIAIFAPISNTKRDYPFYVPLEGTKSTGKVLLDQPVTIDF
RARKYKFVEDIADSLLIELLSRVKVIFEKG
MVEIKQGTIIKINLDPKEGHEQRGYRPYVCLSHSVVQNYSNIAIFAPISNTKRDYPFYVPLEGTKSTGKVLLDQPVTIDF
RARKYKFVEDIADSLLIELLSRVKVIFEKG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|