Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 146153..146629 Replicon chromosome
Accession NZ_LS483381
Organism Streptococcus sobrinus strain NCTC10921

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag DQM69_RS00855 Protein ID WP_002959484.1
Coordinates 146153..146344 (-) Length 64 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U2KLJ0
Locus tag DQM69_RS00860 Protein ID WP_002959487.1
Coordinates 146348..146629 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM69_RS00830 141639..142205 + 567 WP_019781805.1 DUF1211 domain-containing protein -
DQM69_RS10430 142559..142702 - 144 WP_002959475.1 hypothetical protein -
DQM69_RS00835 142692..143105 - 414 WP_019781806.1 hypothetical protein -
DQM69_RS00840 143187..143909 + 723 WP_019776886.1 ABC transporter ATP-binding protein -
DQM69_RS00845 143914..145060 + 1147 Protein_125 ABC transporter permease -
DQM69_RS00850 145284..145904 + 621 WP_002959483.1 TetR/AcrR family transcriptional regulator -
DQM69_RS10505 146082..146174 - 93 WP_197711882.1 type II toxin-antitoxin system YafQ family toxin -
DQM69_RS00855 146153..146344 - 192 WP_002959484.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
DQM69_RS00860 146348..146629 - 282 WP_002959487.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
DQM69_RS00865 146786..147652 - 867 WP_002959489.1 LysR family transcriptional regulator -
DQM69_RS00870 147763..148623 + 861 WP_002959490.1 aldo/keto reductase -
DQM69_RS00875 148723..149085 - 363 WP_002959493.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 125488..170667 45179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-57)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-89)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7151.47 Da        Isoelectric Point: 10.5481

>T292465 WP_002959484.1 NZ_LS483381:c146344-146153 [Streptococcus sobrinus]
MLKLVATKQFKKDLKKIRKRGLALDKLESLIALLQAEEVLPQSYRDHALVGVFENVKSNQTVS

Download         Length: 192 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10517.83 Da        Isoelectric Point: 4.5447

>AT292465 WP_002959487.1 NZ_LS483381:c146629-146348 [Streptococcus sobrinus]
MAKTANINLRIEPETKARAESLFNSFGISVTDAINIFLNTSIMEGGFPFQIKQPRYNHETEAAIEEARRIIAKEEKAKTY
ANLSELLDNLDED

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB U2KLJ0

References