Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1517648..1518260 | Replicon | chromosome |
Accession | NZ_LS483379 | ||
Organism | Streptococcus pyogenes strain NCTC10874 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQM61_RS07740 | Protein ID | WP_002994716.1 |
Coordinates | 1517925..1518260 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQM61_RS07735 | Protein ID | WP_002988079.1 |
Coordinates | 1517648..1517935 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM61_RS07710 | 1512839..1513822 | - | 984 | WP_014407847.1 | tagatose-bisphosphate aldolase | - |
DQM61_RS07715 | 1513826..1514755 | - | 930 | WP_023609980.1 | tagatose-6-phosphate kinase | - |
DQM61_RS07720 | 1514801..1515316 | - | 516 | WP_014407849.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM61_RS07725 | 1515351..1515779 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM61_RS07730 | 1516225..1516998 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM61_RS07735 | 1517648..1517935 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQM61_RS07740 | 1517925..1518260 | + | 336 | WP_002994716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM61_RS09050 | 1518412..1518882 | + | 471 | WP_021733374.1 | site-specific integrase | - |
DQM61_RS09055 | 1518845..1519393 | + | 549 | WP_136115776.1 | site-specific integrase | - |
DQM61_RS07750 | 1519513..1519905 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQM61_RS07755 | 1519926..1520372 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM61_RS07760 | 1520590..1520796 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM61_RS07765 | 1520793..1521299 | - | 507 | WP_002988070.1 | hypothetical protein | - |
DQM61_RS07770 | 1521435..1522295 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQM61_RS07775 | 1522392..1522910 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13154.89 Da Isoelectric Point: 5.6157
>T292463 WP_002994716.1 NZ_LS483379:1517925-1518260 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|