Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1242371..1243044 Replicon chromosome
Accession NZ_LS483378
Organism Streptococcus sobrinus strain NCTC12279

Toxin (Protein)


Gene name hicA Uniprot ID U2KBU0
Locus tag DQM97_RS06065 Protein ID WP_002961998.1
Coordinates 1242862..1243044 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID U2KIH2
Locus tag DQM97_RS06060 Protein ID WP_002961996.1
Coordinates 1242371..1242829 (-) Length 153 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM97_RS06040 1237418..1238623 - 1206 WP_002961989.1 restriction endonuclease subunit S -
DQM97_RS06045 1238637..1239227 - 591 WP_002961990.1 hypothetical protein -
DQM97_RS06050 1239236..1240867 - 1632 WP_002961991.1 RNA-directed DNA polymerase -
DQM97_RS06055 1240960..1242233 - 1274 Protein_1138 hypothetical protein -
DQM97_RS06060 1242371..1242829 - 459 WP_002961996.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
DQM97_RS06065 1242862..1243044 - 183 WP_002961998.1 type II toxin-antitoxin system HicA family toxin Toxin
DQM97_RS06070 1243243..1243506 - 264 WP_002962001.1 type II toxin-antitoxin system RelE/ParE family toxin -
DQM97_RS06075 1243507..1243728 - 222 WP_002962004.1 hypothetical protein -
DQM97_RS06080 1243851..1246847 - 2997 WP_002962006.1 type I restriction endonuclease subunit R -
DQM97_RS06085 1247024..1247965 + 942 WP_002962007.1 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1233415..1243752 10337
- inside Prophage - - 1233415..1249986 16571


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6833.19 Da        Isoelectric Point: 11.1577

>T292461 WP_002961998.1 NZ_LS483378:c1243044-1242862 [Streptococcus sobrinus]
MPMTQKEMVKLLTANGWTKIKGRKGSHIKLEKKGQHPIIVPHGEINKYTERAIRKQAGLL

Download         Length: 183 bp

Antitoxin


Download         Length: 153 a.a.        Molecular weight: 16749.65 Da        Isoelectric Point: 4.0363

>AT292461 WP_002961996.1 NZ_LS483378:c1242829-1242371 [Streptococcus sobrinus]
MLVAYPALFYYDPNEPSANPYFVTFPDIEHSATQGESPAHAILMASDYLGMALADELEQGRSLAQPSDINSLSLEANNPF
KDDEDMTLNYDPDKSFISLVSVDLANYLGSQEPIKKTLTIPRWADRLGRELGLNFSQTLTDAIADKKLGSNS

Download         Length: 459 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U2KBU0

Antitoxin

Source ID Structure
AlphaFold DB U2KIH2

References