Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 826087..826658 | Replicon | chromosome |
| Accession | NZ_LS483378 | ||
| Organism | Streptococcus sobrinus strain NCTC12279 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DQM97_RS04060 | Protein ID | WP_002959724.1 |
| Coordinates | 826087..826419 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | U2KH30 |
| Locus tag | DQM97_RS04065 | Protein ID | WP_002959726.1 |
| Coordinates | 826413..826658 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM97_RS04045 | 821561..823174 | + | 1614 | WP_028798515.1 | alpha-glucosidase | - |
| DQM97_RS04050 | 823724..824233 | + | 510 | WP_002959718.1 | DinB family protein | - |
| DQM97_RS04055 | 824254..825603 | + | 1350 | WP_028798514.1 | replication-associated recombination protein A | - |
| DQM97_RS04060 | 826087..826419 | - | 333 | WP_002959724.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DQM97_RS04065 | 826413..826658 | - | 246 | WP_002959726.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| DQM97_RS04070 | 826809..827573 | - | 765 | WP_019769317.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQM97_RS04075 | 827833..828261 | + | 429 | WP_002959730.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQM97_RS04080 | 828289..828804 | + | 516 | WP_002959732.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQM97_RS04085 | 828944..829924 | + | 981 | WP_002959735.1 | tagatose-bisphosphate aldolase | - |
| DQM97_RS04090 | 830202..831035 | + | 834 | WP_002959738.1 | PRD domain-containing protein | - |
| DQM97_RS04095 | 831072..831386 | + | 315 | WP_002959739.1 | PTS lactose/cellobiose transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12689.79 Da Isoelectric Point: 9.5954
>T292460 WP_002959724.1 NZ_LS483378:c826419-826087 [Streptococcus sobrinus]
MVEIKQGTIIKINLDPKEGHEQRGYRPYVCLSHSVVQNYSNIAIFAPISNTKRDYPFYVPLKGTKSTGKVLLDQLVTIDF
RARKYKFVEDIADSLLIELLSRVKVIFEKE
MVEIKQGTIIKINLDPKEGHEQRGYRPYVCLSHSVVQNYSNIAIFAPISNTKRDYPFYVPLKGTKSTGKVLLDQLVTIDF
RARKYKFVEDIADSLLIELLSRVKVIFEKE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|