Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | sezT-pezA/zeta-couple_hipB |
| Location | 805069..805781 | Replicon | chromosome |
| Accession | NZ_LS483378 | ||
| Organism | Streptococcus sobrinus strain NCTC12279 | ||
Toxin (Protein)
| Gene name | sezT | Uniprot ID | - |
| Locus tag | DQM97_RS03975 | Protein ID | WP_002959684.1 |
| Coordinates | 805545..805781 (+) | Length | 79 a.a. |
Antitoxin (Protein)
| Gene name | pezA | Uniprot ID | - |
| Locus tag | DQM97_RS03970 | Protein ID | WP_002959682.1 |
| Coordinates | 805069..805545 (+) | Length | 159 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM97_RS03950 | 800914..802740 | + | 1827 | WP_028798479.1 | beta-glucoside-specific PTS transporter subunit IIABC | - |
| DQM97_RS03955 | 802751..802912 | + | 162 | WP_002963117.1 | family 1 glycosylhydrolase | - |
| DQM97_RS03960 | 802991..803980 | - | 990 | WP_111679792.1 | IS30 family transposase | - |
| DQM97_RS03965 | 804506..804952 | + | 447 | WP_002959681.1 | SWIM zinc finger domain-containing protein | - |
| DQM97_RS03970 | 805069..805545 | + | 477 | WP_002959682.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DQM97_RS03975 | 805545..805781 | + | 237 | WP_002959684.1 | zeta toxin family protein | Toxin |
| DQM97_RS03980 | 805803..805937 | + | 135 | WP_002959687.1 | zeta toxin family protein | - |
| DQM97_RS03985 | 805975..806322 | + | 348 | Protein_728 | zeta toxin family protein | - |
| DQM97_RS03990 | 806837..809080 | + | 2244 | WP_002959690.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 802991..803980 | 989 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 79 a.a. Molecular weight: 8485.73 Da Isoelectric Point: 10.3607
>T292459 WP_002959684.1 NZ_LS483378:805545-805781 [Streptococcus sobrinus]
MIVAKFTEAELNRALTRNSRALIRGKKPSEHPTAILLGGQSGAGKTTIHRIKQEAYQGNIIVIDGDSFCPQHPNFSAL
MIVAKFTEAELNRALTRNSRALIRGKKPSEHPTAILLGGQSGAGKTTIHRIKQEAYQGNIIVIDGDSFCPQHPNFSAL
Download Length: 237 bp
Antitoxin
Download Length: 159 a.a. Molecular weight: 18052.88 Da Isoelectric Point: 4.8894
>AT292459 WP_002959682.1 NZ_LS483378:805069-805545 [Streptococcus sobrinus]
MIGENIKALRKKRELTQPEFAKIIGISRNSLSRYENGTSSVSTDLLDLICKKFNVSYIDIVGKEKLLRPIEDYQLTLKIE
LAKERGVNLLARLYAFQDEQGIAVDDEANLWVLMGDDLADLVHTKIYLVNTFEEFERYMGYLDGIERMLSMAKQGVAV
MIGENIKALRKKRELTQPEFAKIIGISRNSLSRYENGTSSVSTDLLDLICKKFNVSYIDIVGKEKLLRPIEDYQLTLKIE
LAKERGVNLLARLYAFQDEQGIAVDDEANLWVLMGDDLADLVHTKIYLVNTFEEFERYMGYLDGIERMLSMAKQGVAV
Download Length: 477 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|