Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 147050..147526 Replicon chromosome
Accession NZ_LS483378
Organism Streptococcus sobrinus strain NCTC12279

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag DQM97_RS00875 Protein ID WP_002959484.1
Coordinates 147050..147241 (-) Length 64 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U2KLJ0
Locus tag DQM97_RS00880 Protein ID WP_002959487.1
Coordinates 147245..147526 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM97_RS10760 143446..143589 - 144 WP_002959475.1 hypothetical protein -
DQM97_RS00855 143579..143869 - 291 WP_002959477.1 hypothetical protein -
DQM97_RS00860 144091..144813 + 723 WP_002959479.1 ABC transporter ATP-binding protein -
DQM97_RS00865 144818..145957 + 1140 WP_002959481.1 ABC transporter permease -
DQM97_RS00870 146181..146801 + 621 WP_002959483.1 TetR/AcrR family transcriptional regulator -
DQM97_RS10835 146979..147071 - 93 WP_197711882.1 type II toxin-antitoxin system YafQ family toxin -
DQM97_RS00875 147050..147241 - 192 WP_002959484.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
DQM97_RS00880 147245..147526 - 282 WP_002959487.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
DQM97_RS00885 147683..148549 - 867 WP_002959489.1 LysR family transcriptional regulator -
DQM97_RS00890 148660..149520 + 861 WP_002959490.1 aldo/keto reductase -
DQM97_RS00895 149620..149982 - 363 WP_002959493.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 124679..171490 46811


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-57)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-89)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7151.47 Da        Isoelectric Point: 10.5481

>T292458 WP_002959484.1 NZ_LS483378:c147241-147050 [Streptococcus sobrinus]
MLKLVATKQFKKDLKKIRKRGLALDKLESLIALLQAEEVLPQSYRDHALVGVFENVKSNQTVS

Download         Length: 192 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10517.83 Da        Isoelectric Point: 4.5447

>AT292458 WP_002959487.1 NZ_LS483378:c147526-147245 [Streptococcus sobrinus]
MAKTANINLRIEPETKARAESLFNSFGISVTDAINIFLNTSIMEGGFPFQIKQPRYNHETEAAIEEARRIIAKEEKAKTY
ANLSELLDNLDED

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB U2KLJ0

References