Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 283221..283869 | Replicon | chromosome |
Accession | NZ_LS483377 | ||
Organism | Stenotrophomonas maltophilia strain NCTC10258 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | DQN92_RS01275 | Protein ID | WP_005407702.1 |
Coordinates | 283221..283526 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | DQN92_RS01280 | Protein ID | WP_005407703.1 |
Coordinates | 283567..283869 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQN92_RS01245 | 279172..279963 | - | 792 | WP_172459911.1 | zinc-dependent peptidase | - |
DQN92_RS01250 | 279930..280208 | - | 279 | WP_005411956.1 | hypothetical protein | - |
DQN92_RS01255 | 280353..281321 | + | 969 | WP_062606021.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
DQN92_RS01260 | 281318..282049 | + | 732 | WP_005407698.1 | type III pantothenate kinase | - |
DQN92_RS01265 | 282059..282913 | + | 855 | WP_111686768.1 | SPOR domain-containing protein | - |
DQN92_RS01275 | 283221..283526 | + | 306 | WP_005407702.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQN92_RS01280 | 283567..283869 | + | 303 | WP_005407703.1 | putative addiction module antidote protein | Antitoxin |
DQN92_RS01285 | 284127..284426 | - | 300 | WP_111686769.1 | hypothetical protein | - |
DQN92_RS01290 | 284507..284914 | - | 408 | WP_005407705.1 | hypothetical protein | - |
DQN92_RS01295 | 285509..286279 | + | 771 | WP_005411960.1 | DUF3011 domain-containing protein | - |
DQN92_RS01300 | 286304..286651 | - | 348 | WP_005411961.1 | hypothetical protein | - |
DQN92_RS01305 | 286782..287702 | + | 921 | WP_005407709.1 | arginase | - |
DQN92_RS01310 | 287863..288000 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
DQN92_RS01315 | 288208..288429 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11444.15 Da Isoelectric Point: 10.9897
>T292455 WP_005407702.1 NZ_LS483377:283221-283526 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|