Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 857431..857914 | Replicon | chromosome |
Accession | NZ_LS483368 | ||
Organism | Streptococcus equi subsp. zooepidemicus strain NCTC6176 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A922NVR0 |
Locus tag | DQM56_RS04170 | Protein ID | WP_021320634.1 |
Coordinates | 857654..857914 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A922NW74 |
Locus tag | DQM56_RS04165 | Protein ID | WP_012678125.1 |
Coordinates | 857431..857652 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM56_RS04140 | 853971..854234 | + | 264 | WP_012678127.1 | hypothetical protein | - |
DQM56_RS04145 | 854416..854871 | - | 456 | WP_021320631.1 | DUF1694 domain-containing protein | - |
DQM56_RS04150 | 855103..856410 | + | 1308 | WP_012515409.1 | phosphopyruvate hydratase | - |
DQM56_RS04155 | 856649..856738 | + | 90 | WP_111677961.1 | type I toxin-antitoxin system Fst family toxin | - |
DQM56_RS04160 | 856985..857221 | - | 237 | Protein_779 | transposase | - |
DQM56_RS04165 | 857431..857652 | + | 222 | WP_012678125.1 | hypothetical protein | Antitoxin |
DQM56_RS04170 | 857654..857914 | + | 261 | WP_021320634.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM56_RS04175 | 857992..858968 | + | 977 | Protein_782 | IS3 family transposase | - |
DQM56_RS10090 | 858969..859223 | + | 255 | Protein_783 | HAD family hydrolase | - |
DQM56_RS04185 | 859693..862473 | + | 2781 | WP_111710494.1 | endonuclease/exonuclease/phosphatase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 857992..858507 | 515 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10258.78 Da Isoelectric Point: 9.6925
>T292446 WP_021320634.1 NZ_LS483368:857654-857914 [Streptococcus equi subsp. zooepidemicus]
MYHIEYSKKAQKQIKKLDKQIQRLLFAWIDKHLEGTDNPRANGKGLAGNHANEWRYRIGDYRLICDIQDDKMVILALEFG
HRRDVY
MYHIEYSKKAQKQIKKLDKQIQRLLFAWIDKHLEGTDNPRANGKGLAGNHANEWRYRIGDYRLICDIQDDKMVILALEFG
HRRDVY
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|