Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2054188..2054674 Replicon chromosome
Accession NZ_LS483367
Organism Streptococcus dysgalactiae subsp. equisimilis strain NCTC5371

Toxin (Protein)


Gene name relE Uniprot ID Q48QR0
Locus tag DQM52_RS10340 Protein ID WP_014407961.1
Coordinates 2054188..2054457 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A660A1J7
Locus tag DQM52_RS10345 Protein ID WP_014407962.1
Coordinates 2054447..2054674 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM52_RS10325 2049320..2051593 - 2274 WP_015058145.1 YhgE/Pip domain-containing protein -
DQM52_RS10330 2051728..2052261 + 534 WP_111681933.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
DQM52_RS10335 2052258..2053760 - 1503 WP_111681934.1 IS1182 family transposase -
DQM52_RS10340 2054188..2054457 - 270 WP_014407961.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM52_RS10345 2054447..2054674 - 228 WP_014407962.1 hypothetical protein Antitoxin
DQM52_RS10350 2054806..2055669 - 864 WP_003060834.1 IS982 family transposase -
DQM52_RS10355 2055795..2056166 - 372 WP_046159699.1 ArpU family transcriptional regulator -
DQM52_RS10360 2056141..2056503 - 363 WP_015058149.1 DUF1492 domain-containing protein -
DQM52_RS10365 2056782..2057027 - 246 WP_011285304.1 hypothetical protein -
DQM52_RS10370 2057002..2057277 - 276 WP_014407964.1 hypothetical protein -
DQM52_RS10375 2057267..2057605 - 339 WP_030126557.1 replication protein -
DQM52_RS10380 2057647..2057913 - 267 WP_011285307.1 hypothetical protein -
DQM52_RS10385 2057910..2058698 - 789 WP_015058150.1 hypothetical protein -
DQM52_RS10720 2058789..2058947 - 159 WP_015058151.1 hypothetical protein -
DQM52_RS10390 2058961..2059206 - 246 WP_015058152.1 hypothetical protein -
DQM52_RS10395 2059202..2059528 - 327 Protein_1964 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2032068..2083341 51273
- inside IScluster/Tn - - 2052258..2055669 3411


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10497.50 Da        Isoelectric Point: 10.5027

>T292445 WP_014407961.1 NZ_LS483367:c2054457-2054188 [Streptococcus dysgalactiae subsp. equisimilis]
MTYKLVVSDEVKKQLKKMDKHVGLMLAKDMKKRLDGLNNPRQFGKALTGQYKGLWRYRVGNYRVICDIVDNEMIILALEV
GHRKEIYKR

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8641.63 Da        Isoelectric Point: 3.9607

>AT292445 WP_014407962.1 NZ_LS483367:c2054674-2054447 [Streptococcus dysgalactiae subsp. equisimilis]
MAMVSLRLNSAEEELFRSYATHTGKTLSELFKTALAQQIEDQLDYETGIQALKRFEENPITYSIDDLIEELENDL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A202

Antitoxin

Source ID Structure
AlphaFold DB A0A660A1J7

References