Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TsdAT/- |
| Location | 2163320..2163834 | Replicon | chromosome |
| Accession | NZ_LS483365 | ||
| Organism | Staphylococcus aureus subsp. aureus NCTC 8325 | ||
Toxin (Protein)
| Gene name | TsdT | Uniprot ID | T1YA99 |
| Locus tag | DQM91_RS11450 | Protein ID | WP_000581792.1 |
| Coordinates | 2163320..2163529 (-) | Length | 70 a.a. |
Antitoxin (Protein)
| Gene name | TsdA | Uniprot ID | W8UW13 |
| Locus tag | DQM91_RS11455 | Protein ID | WP_000138932.1 |
| Coordinates | 2163541..2163834 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM91_RS11430 | 2158828..2160186 | - | 1359 | WP_000611465.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| DQM91_RS11435 | 2160201..2161271 | - | 1071 | WP_000159631.1 | D-alanine--D-alanine ligase | - |
| DQM91_RS11440 | 2161589..2162791 | + | 1203 | WP_001109939.1 | rod shape-determining protein RodA | - |
| DQM91_RS11445 | 2163055..2163192 | - | 138 | WP_000828354.1 | hypothetical protein | - |
| DQM91_RS11450 | 2163320..2163529 | - | 210 | WP_000581792.1 | heavy-metal-associated domain-containing protein | Toxin |
| DQM91_RS11455 | 2163541..2163834 | - | 294 | WP_000138932.1 | copper-sensing transcriptional repressor CsoR | Antitoxin |
| DQM91_RS11460 | 2164000..2165484 | + | 1485 | WP_000571549.1 | cardiolipin synthase | - |
| DQM91_RS11465 | 2165512..2166159 | + | 648 | WP_001187629.1 | HD domain-containing protein | - |
| DQM91_RS11485 | 2166972..2167844 | - | 873 | WP_000725802.1 | membrane protein insertase YidC | - |
| DQM91_RS11490 | 2167930..2168571 | - | 642 | WP_000483153.1 | thiamine phosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 70 a.a. Molecular weight: 7843.77 Da Isoelectric Point: 4.1008
>T292438 WP_000581792.1 NZ_LS483365:c2163529-2163320 [Staphylococcus aureus subsp. aureus NCTC 8325]
MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEIYDEGYKIVF
MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEIYDEGYKIVF
Download Length: 210 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 11197.82 Da Isoelectric Point: 6.2243
>AT292438 WP_000138932.1 NZ_LS483365:c2163834-2163541 [Staphylococcus aureus subsp. aureus NCTC 8325]
MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQ
EEAMEELLVTFQKLIKD
MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQ
EEAMEELLVTFQKLIKD
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|