292429

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 811812..812289 Replicon chromosome
Accession NZ_LS483365
Organism Staphylococcus aureus subsp. aureus NCTC 8325

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag DQM91_RS04070 Protein ID WP_000052078.1
Coordinates 811812..812000 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DQM91_RS04075 Protein ID WP_001059690.1
Coordinates 812029..812289 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM91_RS04040 807853..808323 + 471 WP_000824472.1 hypothetical protein -
DQM91_RS04045 808664..809350 + 687 WP_001548082.1 thermonuclease family protein -
DQM91_RS04050 809707..809907 + 201 WP_001059082.1 cold-shock protein -
DQM91_RS04055 810403..810621 - 219 WP_000005886.1 hypothetical protein -
DQM91_RS04060 810683..810967 - 285 WP_001004395.1 hypothetical protein -
DQM91_RS04065 811055..811624 - 570 WP_001106654.1 hypothetical protein -
DQM91_RS04070 811812..812000 - 189 WP_000052078.1 hypothetical protein Toxin
DQM91_RS04075 812029..812289 - 261 WP_001059690.1 hypothetical protein Antitoxin
DQM91_RS04080 812630..812833 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DQM91_RS04085 812830..813066 - 237 WP_000368687.1 hypothetical protein -
DQM91_RS04090 813291..813872 + 582 WP_001140693.1 phosphoglycerate mutase family protein -
DQM91_RS04095 813945..814562 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
DQM91_RS04100 814717..815211 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
DQM91_RS04105 815610..816032 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
DQM91_RS04110 816180..816896 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T292429 WP_000052078.1 NZ_LS483365:c812000-811812 [Staphylococcus aureus subsp. aureus NCTC 8325]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT292429 WP_001059690.1 NZ_LS483365:c812289-812029 [Staphylococcus aureus subsp. aureus NCTC 8325]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References