Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2121068..2121554 Replicon chromosome
Accession NZ_LS483363
Organism Streptococcus dysgalactiae subsp. equisimilis strain NCTC9414

Toxin (Protein)


Gene name relE Uniprot ID Q48QR0
Locus tag DQM58_RS10700 Protein ID WP_014407961.1
Coordinates 2121068..2121337 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A660A1J7
Locus tag DQM58_RS10705 Protein ID WP_014407962.1
Coordinates 2121327..2121554 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM58_RS10685 2116200..2118473 - 2274 WP_015058145.1 YhgE/Pip domain-containing protein -
DQM58_RS10690 2118608..2119141 + 534 WP_111681933.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
DQM58_RS10695 2119138..2120640 - 1503 WP_111681934.1 IS1182 family transposase -
DQM58_RS10700 2121068..2121337 - 270 WP_014407961.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM58_RS10705 2121327..2121554 - 228 WP_014407962.1 hypothetical protein Antitoxin
DQM58_RS10710 2121707..2122078 - 372 WP_046159699.1 ArpU family transcriptional regulator -
DQM58_RS10715 2122053..2122415 - 363 WP_015058149.1 DUF1492 domain-containing protein -
DQM58_RS10720 2122694..2122939 - 246 WP_011285304.1 hypothetical protein -
DQM58_RS10725 2122914..2123189 - 276 WP_014407964.1 hypothetical protein -
DQM58_RS10730 2123179..2123517 - 339 WP_030126557.1 replication protein -
DQM58_RS10735 2123559..2123825 - 267 WP_011285307.1 hypothetical protein -
DQM58_RS10740 2123822..2124610 - 789 WP_015058150.1 hypothetical protein -
DQM58_RS11100 2124701..2124859 - 159 WP_015058151.1 hypothetical protein -
DQM58_RS10745 2124873..2125118 - 246 WP_015058152.1 hypothetical protein -
DQM58_RS10750 2125114..2125440 - 327 Protein_2037 hypothetical protein -
DQM58_RS11105 2125442..2125615 - 174 WP_015058154.1 hypothetical protein -
DQM58_RS10755 2125621..2125794 - 174 WP_015058155.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2098948..2149253 50305
- flank IS/Tn - - 2119138..2120640 1502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10497.50 Da        Isoelectric Point: 10.5027

>T292428 WP_014407961.1 NZ_LS483363:c2121337-2121068 [Streptococcus dysgalactiae subsp. equisimilis]
MTYKLVVSDEVKKQLKKMDKHVGLMLAKDMKKRLDGLNNPRQFGKALTGQYKGLWRYRVGNYRVICDIVDNEMIILALEV
GHRKEIYKR

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8641.63 Da        Isoelectric Point: 3.9607

>AT292428 WP_014407962.1 NZ_LS483363:c2121554-2121327 [Streptococcus dysgalactiae subsp. equisimilis]
MAMVSLRLNSAEEELFRSYATHTGKTLSELFKTALAQQIEDQLDYETGIQALKRFEENPITYSIDDLIEELENDL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A202

Antitoxin

Source ID Structure
AlphaFold DB A0A660A1J7

References