Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 272278..272890 | Replicon | chromosome |
Accession | NZ_LS483363 | ||
Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC9414 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q8E7D3 |
Locus tag | DQM58_RS01520 | Protein ID | WP_000384859.1 |
Coordinates | 272278..272613 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | G5KDE1 |
Locus tag | DQM58_RS01525 | Protein ID | WP_006738697.1 |
Coordinates | 272603..272890 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM58_RS01495 | 268002..268436 | + | 435 | WP_001220480.1 | hypothetical protein | - |
DQM58_RS01500 | 268753..270009 | + | 1257 | WP_111681514.1 | plasmid recombination protein | - |
DQM58_RS01505 | 270177..270665 | + | 489 | WP_111681515.1 | hypothetical protein | - |
DQM58_RS01510 | 270711..271844 | + | 1134 | WP_022554244.1 | ISAs1-like element IS1548 family transposase | - |
DQM58_RS01520 | 272278..272613 | - | 336 | WP_000384859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM58_RS01525 | 272603..272890 | - | 288 | WP_006738697.1 | hypothetical protein | Antitoxin |
DQM58_RS01530 | 273101..273184 | + | 84 | Protein_248 | 30S ribosomal protein S9 | - |
DQM58_RS01535 | 273295..274515 | - | 1221 | WP_111681516.1 | tyrosine-type recombinase/integrase | - |
DQM58_RS01540 | 274584..274844 | - | 261 | WP_111681517.1 | helix-turn-helix domain-containing protein | - |
DQM58_RS01545 | 274822..275421 | - | 600 | WP_111681518.1 | replication protein | - |
DQM58_RS01550 | 275612..276223 | - | 612 | WP_070811395.1 | hypothetical protein | - |
DQM58_RS01555 | 276223..277299 | - | 1077 | WP_111681949.1 | cell division protein FtsK | - |
DQM58_RS01560 | 277309..277586 | - | 278 | Protein_254 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 270711..271844 | 1133 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.98 Da Isoelectric Point: 4.6565
>T292426 WP_000384859.1 NZ_LS483363:c272613-272278 [Streptococcus dysgalactiae subsp. equisimilis]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10878.45 Da Isoelectric Point: 4.7271
>AT292426 WP_006738697.1 NZ_LS483363:c272890-272603 [Streptococcus dysgalactiae subsp. equisimilis]
MVTAEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEISKNIEDVRQ
GKFYTSEEVRAELGL
MVTAEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEISKNIEDVRQ
GKFYTSEEVRAELGL
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|