Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1631021..1631633 | Replicon | chromosome |
| Accession | NZ_LS483360 | ||
| Organism | Streptococcus pyogenes strain NCTC10876 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A4Z2JY48 |
| Locus tag | DQM47_RS08450 | Protein ID | WP_002982731.1 |
| Coordinates | 1631298..1631633 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQM47_RS08445 | Protein ID | WP_002988079.1 |
| Coordinates | 1631021..1631308 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM47_RS08420 | 1626200..1627183 | - | 984 | WP_023610648.1 | tagatose-bisphosphate aldolase | - |
| DQM47_RS08425 | 1627187..1628116 | - | 930 | WP_023610632.1 | tagatose-6-phosphate kinase | - |
| DQM47_RS08430 | 1628164..1628679 | - | 516 | WP_002982748.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQM47_RS08435 | 1628714..1629142 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQM47_RS08440 | 1629587..1630360 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQM47_RS08445 | 1631021..1631308 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQM47_RS08450 | 1631298..1631633 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM47_RS09950 | 1631761..1632255 | + | 495 | WP_032465896.1 | site-specific integrase | - |
| DQM47_RS09955 | 1632218..1632580 | + | 363 | WP_180372423.1 | tyrosine-type recombinase/integrase | - |
| DQM47_RS09960 | 1632616..1632765 | + | 150 | WP_011285175.1 | integrase | - |
| DQM47_RS08460 | 1633137..1634348 | - | 1212 | WP_013851451.1 | hypothetical protein | - |
| DQM47_RS08465 | 1634550..1635422 | + | 873 | WP_023610636.1 | hypothetical protein | - |
| DQM47_RS08470 | 1635437..1635907 | + | 471 | WP_111695860.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1610775..1643481 | 32706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292424 WP_002982731.1 NZ_LS483360:1631298-1631633 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Z2JY48 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |