Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1516853..1517465 Replicon chromosome
Accession NZ_LS483359
Organism Streptococcus pyogenes strain NCTC12068

Toxin (Protein)


Gene name parE Uniprot ID Q5X9X8
Locus tag DQL29_RS07625 Protein ID WP_011018227.1
Coordinates 1517130..1517465 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQL29_RS07620 Protein ID WP_002988079.1
Coordinates 1516853..1517140 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL29_RS07595 1512044..1513027 - 984 WP_030126263.1 tagatose-bisphosphate aldolase -
DQL29_RS07600 1513031..1513960 - 930 WP_030126262.1 tagatose-6-phosphate kinase -
DQL29_RS07605 1514006..1514521 - 516 WP_014407849.1 galactose-6-phosphate isomerase subunit LacB -
DQL29_RS07610 1514556..1514984 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
DQL29_RS07615 1515430..1516203 + 774 WP_002993783.1 DeoR/GlpR family DNA-binding transcription regulator -
DQL29_RS07620 1516853..1517140 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQL29_RS07625 1517130..1517465 + 336 WP_011018227.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQL29_RS07630 1517617..1518087 + 471 WP_111718001.1 site-specific integrase -
DQL29_RS07635 1518201..1518551 + 351 WP_194117792.1 tyrosine-type recombinase/integrase -
DQL29_RS07640 1518719..1519111 - 393 WP_030126260.1 30S ribosomal protein S9 -
DQL29_RS07645 1519132..1519578 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQL29_RS07650 1519796..1520002 - 207 WP_011285176.1 helix-turn-helix transcriptional regulator -
DQL29_RS07655 1519999..1520697 - 699 WP_030126259.1 hypothetical protein -
DQL29_RS07660 1520833..1521693 - 861 WP_030126258.1 DegV family protein -
DQL29_RS07665 1521790..1522308 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13171.97 Da        Isoelectric Point: 5.2144

>T292423 WP_011018227.1 NZ_LS483359:1517130-1517465 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292423 WP_002988079.1 NZ_LS483359:1516853-1517140 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z2QKE7

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References