Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 2067342..2068057 | Replicon | chromosome |
Accession | NZ_LS483358 | ||
Organism | Actinobacillus pleuropneumoniae strain NCTC11384 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DQM70_RS09880 | Protein ID | WP_005609264.1 |
Coordinates | 2067342..2067770 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B0BT01 |
Locus tag | DQM70_RS09885 | Protein ID | WP_005599447.1 |
Coordinates | 2067770..2068057 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM70_RS09865 | 2062927..2064633 | - | 1707 | WP_005606484.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
DQM70_RS09870 | 2064729..2065010 | - | 282 | WP_005599441.1 | DNA-directed RNA polymerase subunit omega | - |
DQM70_RS09875 | 2065137..2067218 | - | 2082 | WP_005606488.1 | ATP-dependent DNA helicase RecG | - |
DQM70_RS09880 | 2067342..2067770 | - | 429 | WP_005609264.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DQM70_RS09885 | 2067770..2068057 | - | 288 | WP_005599447.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DQM70_RS09890 | 2068263..2069978 | + | 1716 | WP_005606494.1 | proline--tRNA ligase | - |
DQM70_RS09895 | 2070044..2070232 | - | 189 | WP_005602684.1 | hypothetical protein | - |
DQM70_RS09900 | 2070235..2070816 | - | 582 | WP_005606496.1 | sigma-70 family RNA polymerase sigma factor | - |
DQM70_RS09905 | 2070905..2071861 | + | 957 | WP_005619040.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
DQM70_RS09910 | 2071861..2072454 | + | 594 | WP_005606498.1 | sulfoxide reductase heme-binding subunit YedZ | - |
DQM70_RS09915 | 2072646..2072864 | - | 219 | Protein_1890 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16455.92 Da Isoelectric Point: 8.2641
>T292422 WP_005609264.1 NZ_LS483358:c2067770-2067342 [Actinobacillus pleuropneumoniae]
MFQYLFDTNIISELYKLGSNRMDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQA
KSFSINNEIALLASEYHIPNKMDLNDAYIAATAKYHNLVLVTRNLKDFNCCDIRLFNPFEPN
MFQYLFDTNIISELYKLGSNRMDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQA
KSFSINNEIALLASEYHIPNKMDLNDAYIAATAKYHNLVLVTRNLKDFNCCDIRLFNPFEPN
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|