Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1761344..1762075 | Replicon | chromosome |
| Accession | NZ_LS483358 | ||
| Organism | Actinobacillus pleuropneumoniae strain NCTC11384 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | B0BRD2 |
| Locus tag | DQM70_RS08240 | Protein ID | WP_005605461.1 |
| Coordinates | 1761344..1761811 (-) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | B0BRD3 |
| Locus tag | DQM70_RS08245 | Protein ID | WP_005619269.1 |
| Coordinates | 1761815..1762075 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM70_RS08215 | 1756699..1757070 | - | 372 | WP_005605451.1 | CrcB family protein | - |
| DQM70_RS08220 | 1757073..1758137 | - | 1065 | WP_043990971.1 | MFS transporter | - |
| DQM70_RS08225 | 1758232..1759341 | + | 1110 | WP_005605455.1 | anhydro-N-acetylmuramic acid kinase | - |
| DQM70_RS08230 | 1759395..1760309 | + | 915 | WP_005605457.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| DQM70_RS08235 | 1760379..1761260 | - | 882 | WP_043990972.1 | 50S ribosomal protein L11 methyltransferase | - |
| DQM70_RS08240 | 1761344..1761811 | - | 468 | WP_005605461.1 | GNAT family N-acetyltransferase | Toxin |
| DQM70_RS08245 | 1761815..1762075 | - | 261 | WP_005619269.1 | DUF1778 domain-containing protein | Antitoxin |
| DQM70_RS08250 | 1762196..1763656 | - | 1461 | WP_005605463.1 | metalloprotease TldD | - |
| DQM70_RS08255 | 1763786..1765045 | + | 1260 | WP_005605465.1 | tRNA lysidine(34) synthetase TilS | - |
| DQM70_RS08260 | 1765072..1765362 | - | 291 | WP_005598848.1 | DUF5389 family protein | - |
| DQM70_RS08265 | 1765364..1766257 | - | 894 | WP_005605467.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17276.25 Da Isoelectric Point: 9.5125
>T292421 WP_005605461.1 NZ_LS483358:c1761811-1761344 [Actinobacillus pleuropneumoniae]
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVRDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNQQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVRDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNQQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|