Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1556365..1557010 | Replicon | chromosome |
Accession | NZ_LS483358 | ||
Organism | Actinobacillus pleuropneumoniae strain NCTC11384 |
Toxin (Protein)
Gene name | toxT | Uniprot ID | B0BQU7 |
Locus tag | DQM70_RS07230 | Protein ID | WP_005619674.1 |
Coordinates | 1556639..1557010 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | DQM70_RS07225 | Protein ID | WP_005598477.1 |
Coordinates | 1556365..1556658 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM70_RS07195 | 1551697..1552380 | - | 684 | WP_005605188.1 | arginine ABC transporter permease ArtM | - |
DQM70_RS07200 | 1552380..1553051 | - | 672 | WP_005605189.1 | arginine ABC transporter permease ArtQ | - |
DQM70_RS07205 | 1553057..1553791 | - | 735 | WP_005605190.1 | transporter substrate-binding domain-containing protein | - |
DQM70_RS07210 | 1553796..1554530 | - | 735 | WP_005605201.1 | arginine ABC transporter ATP-binding protein ArtP | - |
DQM70_RS07215 | 1554755..1555252 | - | 498 | WP_005601953.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
DQM70_RS07220 | 1555325..1556287 | + | 963 | WP_005619672.1 | calcium/sodium antiporter | - |
DQM70_RS07225 | 1556365..1556658 | - | 294 | WP_005598477.1 | helix-turn-helix domain-containing protein | Antitoxin |
DQM70_RS07230 | 1556639..1557010 | - | 372 | WP_005619674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM70_RS07235 | 1557204..1558955 | + | 1752 | WP_005601957.1 | protein-disulfide reductase DsbD | - |
DQM70_RS07240 | 1559013..1559582 | + | 570 | WP_005605204.1 | elongation factor P hydroxylase | - |
DQM70_RS07245 | 1559626..1560480 | - | 855 | WP_005605207.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15066.57 Da Isoelectric Point: 10.4054
>T292420 WP_005619674.1 NZ_LS483358:c1557010-1556639 [Actinobacillus pleuropneumoniae]
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|