Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 1461259..1461767 | Replicon | chromosome |
Accession | NZ_LS483358 | ||
Organism | Actinobacillus pleuropneumoniae strain NCTC11384 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B0BQK9 |
Locus tag | DQM70_RS06745 | Protein ID | WP_005605064.1 |
Coordinates | 1461507..1461767 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A3N1S6 |
Locus tag | DQM70_RS06740 | Protein ID | WP_005605062.1 |
Coordinates | 1461259..1461510 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM70_RS06695 | 1456671..1457219 | - | 549 | WP_005605049.1 | type IV pilus biogenesis/stability protein PilW | - |
DQM70_RS06700 | 1457273..1458454 | - | 1182 | WP_005605050.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
DQM70_RS06730 | 1459482..1460921 | + | 1440 | WP_005605060.1 | glutamate--tRNA ligase | - |
DQM70_RS06740 | 1461259..1461510 | + | 252 | WP_005605062.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
DQM70_RS06745 | 1461507..1461767 | + | 261 | WP_005605064.1 | Txe/YoeB family addiction module toxin | Toxin |
DQM70_RS06750 | 1461926..1462093 | - | 168 | WP_005605066.1 | Trm112 family protein | - |
DQM70_RS06755 | 1462095..1463075 | - | 981 | WP_005605069.1 | tetraacyldisaccharide 4'-kinase | - |
DQM70_RS06760 | 1463170..1464429 | - | 1260 | WP_111705952.1 | ATP-dependent protease ATP-binding subunit ClpX | - |
DQM70_RS06765 | 1464429..1465019 | - | 591 | WP_005598326.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
DQM70_RS06770 | 1465141..1465533 | + | 393 | WP_005620423.1 | SufE family protein | - |
DQM70_RS06785 | 1465892..1466665 | - | 774 | WP_043990950.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10423.99 Da Isoelectric Point: 8.0109
>T292419 WP_005605064.1 NZ_LS483358:1461507-1461767 [Actinobacillus pleuropneumoniae]
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|