Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 834744..835394 | Replicon | chromosome |
| Accession | NZ_LS483358 | ||
| Organism | Actinobacillus pleuropneumoniae strain NCTC11384 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | DQM70_RS03850 | Protein ID | WP_005604115.1 |
| Coordinates | 835005..835394 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | B0BNU4 |
| Locus tag | DQM70_RS03845 | Protein ID | WP_005604117.1 |
| Coordinates | 834744..835004 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM70_RS03825 | 829764..830384 | - | 621 | WP_005596976.1 | hypothetical protein | - |
| DQM70_RS03830 | 830395..831588 | - | 1194 | WP_005604123.1 | deferrochelatase/peroxidase EfeB | - |
| DQM70_RS03835 | 831600..832412 | - | 813 | WP_005604121.1 | EfeM/EfeO family lipoprotein | - |
| DQM70_RS03840 | 832589..834610 | + | 2022 | WP_005604119.1 | excinuclease ABC subunit B | - |
| DQM70_RS03845 | 834744..835004 | + | 261 | WP_005604117.1 | hypothetical protein | Antitoxin |
| DQM70_RS03850 | 835005..835394 | + | 390 | WP_005604115.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DQM70_RS03855 | 835530..836753 | + | 1224 | WP_005604113.1 | ATP-binding protein | - |
| DQM70_RS03860 | 836879..840153 | + | 3275 | Protein_749 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14895.21 Da Isoelectric Point: 4.8482
>T292418 WP_005604115.1 NZ_LS483358:835005-835394 [Actinobacillus pleuropneumoniae]
MYMLDTNTVSYFFRQDPTVVKKLQQLNPELICISSVTAAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQL
RAEMEREGKIMGVQDQMIGAHALETECVLVSSDKAFQFIPNLVLENWWK
MYMLDTNTVSYFFRQDPTVVKKLQQLNPELICISSVTAAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQL
RAEMEREGKIMGVQDQMIGAHALETECVLVSSDKAFQFIPNLVLENWWK
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|