Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1643905..1644517 Replicon chromosome
Accession NZ_LS483357
Organism Streptococcus pyogenes strain NCTC8326

Toxin (Protein)


Gene name parE Uniprot ID Q1JJZ2
Locus tag DQM46_RS08545 Protein ID WP_002988077.1
Coordinates 1644182..1644517 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQM46_RS08540 Protein ID WP_002988079.1
Coordinates 1643905..1644192 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM46_RS08515 1639094..1640077 - 984 WP_011529001.1 tagatose-bisphosphate aldolase -
DQM46_RS08520 1640081..1641010 - 930 WP_011529002.1 tagatose-6-phosphate kinase -
DQM46_RS08525 1641058..1641573 - 516 WP_011529003.1 galactose-6-phosphate isomerase subunit LacB -
DQM46_RS08530 1641608..1642036 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
DQM46_RS08535 1642482..1643255 + 774 WP_011529005.1 DeoR/GlpR family DNA-binding transcription regulator -
DQM46_RS08540 1643905..1644192 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQM46_RS08545 1644182..1644517 + 336 WP_002988077.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM46_RS08550 1644656..1644832 + 177 Protein_1574 tyrosine-type recombinase/integrase -
DQM46_RS08560 1644963..1645355 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQM46_RS08565 1645376..1645822 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQM46_RS08570 1646040..1646246 - 207 WP_011529007.1 helix-turn-helix transcriptional regulator -
DQM46_RS08575 1646243..1646941 - 699 WP_021299047.1 hypothetical protein -
DQM46_RS08580 1647077..1647937 - 861 WP_011529009.1 DegV family protein -
DQM46_RS08585 1648034..1648552 - 519 WP_011055010.1 NYN domain-containing protein -
DQM46_RS08590 1648556..1649302 - 747 WP_010922667.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13117.83 Da        Isoelectric Point: 5.2144

>T292417 WP_002988077.1 NZ_LS483357:1644182-1644517 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292417 WP_002988079.1 NZ_LS483357:1643905-1644192 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A660A236

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References